#this is why I joined the yiga clan | Explore Tumblr Posts and Blogs

ridreamir · 11 months

Text

Setting: Tears of the Kingdom/Breath of the Wild and Pre-Calamity

This is a condensed reader insert, no gender is ever specified in my writing. (Various x Reader with focus on the Yiga Clan/Master Kohga) Edit: I didn't have time to proofread. I'll keep fixing the post each time I spot a mistake.

So what if, one hundred years ago, there had been a forgotten member of the royal family (by blood or by adoption?) This could be because of a timeline erasure or time split, but this person somehow still exists in the BOTW timeline before the events of the Calamity.

That person just so happens to be you.

Forgotten by the world, you're left to be a wandering traveler in a now post-apocalyptic Hyrule, but you still have a small connection to the power that saved you from certain death/erasure from existence.

Along your travels, you meet members of the various races, and those who were once aware of your existence can no longer recognize you, but those of significant bloodlines too carry faint traces of power not unlike that inherent in your own family. You hide your identity, but you meet old acquaintances and quietly resolve potential threats before they happen before leaving as quickly as you came.

This, of course, is met with no thanks, as you try to avoid being noticed as anything more than an insignificant traveler. Gentle rains, warm breezes, the air that follows feels vaguely reminiscent of a time before the kingdom's fall, and those old enough to remember those times now long past feel melancholic for the brief moment you pass through their lands. The light of the sunrise is stark upon the land, even in mist or morning fog.

During your time passing through the domain, a somewhat young Sidon might find you standing before Mipha's statue with your hands clasped together whilst everyone is sleeping, silently communicating the tales of your adventures through prayer.

He's easily caught spying with his large size, but you pretend not to notice as it makes no sense for a stranger like you to dwell on the memory of a long-passed princess. It probably looked like a passerby paying respect to the spirits. Eventually, he did come out of hiding to join you in paying your respects to the statue. Seeing her face immortalized in stone did stir unrestful feelings within you. You don't know why you survived when everyone else had perished, but you had a feeling there was still something here you must do. You weren't supposed to be alive, but having awoken with limited memories, you realized there were no records left of your existence as a member of the royal family, nor were you sure what role you were meant to play now that your existence had been nothing but a faded memory that only you had held onto.

As you traveled, you also slowly regained pivotal memories of the timeline you had hailed from.

Ironically, you had met your end at the hands of an assassin in disguise. It was just after the revelation of the divine prophecy given of a hero and the crowned princess, your death surely nothing more than a mistake that could have been avoided had you been important enough to protect.

Worse was that you had later realized that you had befriended a strange and silly traveler who had quite the personality, and would sneak away in disguise to meet with him. Sharing snacks purchased together in the market and getting up to shenanigans had become a frequent occurrence, and not once did you think that you'd be caught as the isolated member of the royal family that bore no importance to the monarchy or the crown. He was carefree, mischievous, and had a strange sense of humor that did not fail to amuse you. He might've not been the most pious person before you met, but he learned to pay for the treats you shared. He might have also been the only person to actually like you as a person and not hold contempt for you as a discarded royal.

But it seemed that friend of yours that became dear to you had also been lying about his true identity.

In this new life, you would find yourself desperately stranded in the middle of the desert, just after a violent sandstorm had brought you to a canyon strangely decorated with hanging talismans. It seemed to be the only place safe from the whipping winds that shredded your clothes and cut your skin. You'd felt compelled to see what had become of Gerudo town after the war, as the Gerudo and the Rito had all but cut themselves off from the rest of the world given their difficult-to-reach positions and the danger that now shattered this land.

But just as you thought you were safe, an arrow came flying past your shoulder. A piercing pain coursed throughout your veins, and it became evident that your assailant had not missed his mark. You were awake long enough to watch the world turn sideways before a pair of boots kicked the sand up and obscured the last of your vision. You awoke in a jail cell.

You could not see who stood before you, but you heard as he asked your reason for coming this far through the harsh desert sandstorm.

Of course, this was an interrogation. You were in an unfamiliar place, but something about here had been far too familiar for comfort. This man before you had been the cause of your death.

And this time, he seemed to really think you were just some poor, unfortunate traveler who happened to get swept up in the storm, and not the forgotten royal of a deposed family.

So, you played into his misconception. You supposed it wasn't far from the truth now that you were really just a nobody, but in the back of your mind, you kept looking for signs that this man before you had been the scoundrel who stole from stalls and offered up his spoils to you, his dear friend. His deep, dark eyes and kind smile had probably been a lie as well. The Yiga were known for their disguises, and you were a fool even up until now, holding the memory of him in fondness. That reality of yours was never true to begin with.

He was now introduced to you as the Head of the Yiga Clan. This was "Master Kohga."

165 notes · View notes

lolilou-lagaf · 7 months

Text

I’m re-watching the ToTK cinematic and I was thinking about the story.

The sages are so undeveloped, but there's so much missed potential with the Sage of Lightning specifically?? (spoiler under the cut)

Like Rauru, just, gave a secret stone to a Gerudo after their goddamn king killed his wife, really? Why? How? And why is a Gerudo siding against her King? Yes Ganondorf is evil but they were chill with it when he sent a bunch of Molduga to Hyrule.

Well ok, they probably were not all chill with it. The Sage of Lightning definitely doesn't like Ganondorf, so she probably didn’t like him before the whole bloody moon thing. But how did she convince Rauru to let her join them? She had to give him a hell of speech and to prove herself if she didn’t want to be killed on sight after the death of the queen. Raaah I wish we could have seen this.

Not wait Zelda! Zelda know the Gerudo are going to be good guys(? good gals?) in the futur, and she saw Urbosa as a mother figure! When she saw a cool Gerudo warrior she definitly was like "yeah she's trust worthy and also her descendant is going to adopt me so we should let her join". But i wish we saw more interaction with sages.

I also wish to know what the hell was the sage of Lightning doing before Ganondorf stole the stone. Because there is only 2 option:

She was part of Ganondorf's clan, probably a lower rank that didn't know much about the king but still swear to fight for him and became horrified when she saw what he would do with power (less likely but interesting)

She wasn't part of the clan and was already opposing Ganondorf as the King of the Gerudo. (more likely but less drama, although she could already have some rivalry with him and make thing harder in his political maneuver in Hyrule)

And were all the Gerudo suddenly abandoning their king after he finally became the ruler of Hyrule? Yes yes, monsters and malice are not the best politics, but all of them? Ganon probably didn’t care about his own race, he was probably only seeing them as a tool for his egomaniac quest of power. But some of them had to stick around because they were following him for so long. They were probably even aware of what he wanted to do, so I don’t think they would be surprised when he became evil.

Wait, but there is some follower of Ganon, the Yiga! But they are descendants of Sheika??? It would make more sense if they were descendants of Gerudo that followed Ganondorf, even after his ascension. It could also link (haha) to BotW quest when the Yiga clan targeted the Gerudo's artefact.

In conclusion: I need more story about the Gerudo

#zelda totk #gerudo #ganondorf #sage of lightning #random thought

25 notes · View notes

go-to-the-mirror · 1 year

Text

If you get Jon's self-loathing and curiosity stats high enough, it'll override his cowardice stat.

Yeah so hi time for MAG 143!!! This is... not my favourite episode, but it's alright, I mean Helen's there, and I love Helen.

So, might not have that much to say, but I sure will be speaking. (Update! I do have good words! My brain is so cool you guys)

@a-mag-a-day

BASIRA Eyes peeled. [Pause.] ARCHIVIST Was that a joke?

I'm holding him gently <3

ARCHIVIST They weren’t lying. BASIRA Wait, you did your… ARCHIVIST Oh, yeah, I don’t think they noticed.

Mate, he was purposefully compelling people back in season 3, like, if you have the power to get 100% accurate information then why wouldn't you use it? Monster anyway, you know, might as well use it to your advantage.

BASIRA So what? This was another waste of time? No church. No Dark Sun. I’m going to kill that son of a bitch.

Please.

ARCHIVIST Oh, charming.

He's a fucking dork, you honour <3

ARCHIVIST (Compelling) What happened? MANUELA Don’t … Don’t make me. Please. ARCHIVIST (Compelling) Tell me.

Jon.

And it's like, Basira isn't protesting, but like, I sort of get it? We know about the dreams, we know that his... victims... are suffering, but Scrutiny is like, yeah. They are. Like, I can understand why Basira wouldn't view Jon... yk, compelling people as a bad thing here? It's useful, and she values that, but she doesn't really get the after effects? Maybe? Or maybe it's just because Manuela is "evil" and therefore "deserves it."

Jon does know what happens to them though, and directly...

Oh, right. Not gonna say what I just came to a conclusion on in case it's stupid but I Got Something.

Hither Green was, I believe, where your institute was watching, but Natalie’s efforts were a small and meagre part of the greater effort.

She was literally unscrewing lightbulbs. How was that supposed to end the world???

But we got so close. We touched it. There is another world, a world of still and quiet darkness, where no heat touches and death cannot find you. You might wander beneath that empty sky of void forever and never see a light to guide your way.

But, see, this could be the Lonely, the Extinction, hell even the End, or the Vast. This is not a purely dark world, there is no such thing. Like the colour green. All the green we see, is not true green.

For that night is not empty, far from it. Things move there: the sounds of shuffling, scuttling, crawling. A scream. The fall of gentle stagnant raindrops that chills you as you try desperately to know if that is the sound of the storm or something out there?

The Hunt, The Slaughter, this isn't simply dark.

Natalie and the others followed, but they did not truly understand.

Yeah, duh, she was unscrewing lightbulbs.

Also like, it's actually like... not just spooky cult, but like Natalie joined after her mum died, Manuela left another cult. Feels like a cross between an actual cult, a ✨spooky✨ cult, and the Yiga Clan from Breath of the Wild.

All at once, that loving embrace was stripped from us, and it began to retreat, to recede back into the place that it had come from. We were so close. We were so close.

She sounds so heartbroken.

ARCHIVIST (Compelling) How dangerous is it? MANUELA Only myself, Maxwell and Natalie could even look upon it. It will annihilate you both in an instant. BASIRA Ask her how we can destroy it. ARCHIVIST I know how. I just need to see it. BASIRA See, as in… ARCHIVIST As in, actually see it. MANUELA Go ahead. Just try. BASIRA Look, it’s alright, Jon. No-one else knows it’s here, and if we just leave it, no one will know. ARCHIVIST No, I’m doing this. Get out.

(basira voice) JON! You stupid idiot!

No, but... is this curiosity? Maybe, he's done a similar thing of knowing that he will get hurt and yet doing something anyways for information. Is this because of the self loathing? Maybe, feels pretty similar to "no one can get out of the buried" and then he goes into the buried.

He's not a stupid idiot, he has a reason, but it's a bad reason.

[Static can be heard, growing louder] ARCHIVIST It’s… it's beautiful. MANUELA (Gasps) No! [The static suddenly stops]

I've been thinking about what it would look like, and I think I've come up with a good image of it. You know when you close your eyes - you might have to put your hands over them - and you can see patterns? And you can find that darkness and follow it, and it becomes darker, darker, yet darker (/ref) ad infinitum. You can just stare at the darkness when your eyes are closed, until it's darker than it should even be possible to be dark, and still getting darker.

That's what looking in the dark sun is like, at least I think.

ARCHIVIST Did you catch her? HELEN Yes. (The Archivist gasps.)

Great gasping, Jonny, ten out of ten!

No but... that is great gasping. Jonny's voice acting is just really good.

HELEN How was it, looking upon The Dark? ARCHIVIST I thought I was going to die. HELEN You seem to think that a lot. I remember when you thought you were going to die at my threshold. ARCHIVIST Yeah.

I CARE THEM YOUR HONOUR

Like, hhh just the way they deliver their lines first of all, how can you have so much fucking baggage in a single "Yeah." Like?? The pause, the light tone of Helen vs the "I have just been through another traumatizing event, are you really reminding me of a previous one" tone of Jon.

Drawing the parallels from 101 to this episode? Would you die to save the world? Every time Jon has answered yes. Also the door was locked and this helped end the world? That's fucked? The door was locked? He would have made that choice, save yourself, safe the world, but the door was locked, like??? And here, he made the choice, look at the dark sun, make sure they can never attempt it again, die, and he chose to do that, but all it did was bring Jonah Magnus one step further along his evil plan.

I have like so many feelings about Jon and Helen, so many feelings about this one bit of dialogue. "I thought I was going to die." OH MY GODDD

NO one gets them like I do. They're my blorbos your honour, and they're so fucked up and evil, and they're so fucked up full stop.

Once again tag me in ALL Crew QnA Jon traumatizing people who worked on tma edition I want to see them so much!!!!

HELEN Go find your Basira, then let’s get you both home.

"Home."

#tma #the magnus archives #mag 143 #jonathan sims #helen distortion #helen #a mag a day #jonathan sims + helen distortion #tma meta #is there a tag for jon and helen?#hm #anyway please talk to me about jon and helen #i want to talk about them #always #landscaping your mind chapter one

27 notes · View notes

1tsjusty0u · 1 month

Note

YIGA CLAN! what are they up to....what are they doing...

OH ough so haha funny story actually..!

they sure are Doing. theyre actually banned from certain places and by banned i mean met with ruthlessness and immediate . not violence but the places where theyre banned from Will resort to that its just theyll drive them away by firing warning shock to freeze shots, to actively shooting them and starting a fight. these places include zoras domain, rito village (though less hostile), gerudo town, and kakariko village (for more obvious reasons, uh. oh man this causes grade a Problems for cado. poor guy). thered be more but theres not a lot of villages left standing, and most hylian towns only know them as bandits and nothing more. the zora were Really headstrong with the yiga, sometimes actively hunting them in areas they were in, and during the calamity their anger surged MASSIVELY with miphas death but then . turned over? rolled over? mellowed out later on. hey like a wave tide. but anyways yeah they dont hunt them anymore thankfully. the rito dont either and are honestly the better of the places to get caught by. they arent that angry but they do ban them and escort them out through whatever means they have to. most yiga only really go to hebra rather than rito village so its mostly chill. teba is a little more forceful to the yiga though- revali was known to be extremely pissed at them, enough to find and raid their hideout and wouldve done it alone were it not for urbosa. however teba doesnt want them all dead. revali doesnt either really but he absolutely uses them at target practice he doesnt like them. and kakariko village!! they dont hunt yiga really. theyre close knit and dont really Leave so they mostly just observe the travelers who pass by. yiga can station near kakariko to get to link however inside the village is immediate fury. some shekiah Wouldnt be lenient towards them. at all. theyd likely escort them out or question them, letting impa do some of the work. luckily none have been killed when caught but they absolutely sustained injuries. gerudo town is surprisingly less angry? than the others? like yeah theyll point their weapons towards you once they know youre a yiga but theyll warn you to get out or get bularia. theyre more of a nuisance rather than a true threat (besides the thunder helm). but urbosa surprisingly didnt send anyone after them though she did task them with finding the hideout. no this was personal to her and she had to be physically restrained from committing an actual war crime. goron city isnt chill with them but they arent really banned? per say? they mostly dont know about the yiga daruk didnt have the others hunt them down and was pretty quiet about it. like urbosa it was more personal to him which meant He had to deal with it, as it wasnt his comrades problem. also as death mountain became active again the yiga decided it really wasnt worth it to go there. theres easier places to get em

so whatre they doing!! theyre still robbing places for valuables and such and still going after the thunder helm and gerudo things like bowls and such. but they actually lay fairly low compared to canon. they dont destroy stables or kill people like in gboh (i dont know. if seldon died to the yiga actually, or even if the stables are Their fault but just to clarify yeag they dont do that. also SELDON D: ). they only go after link but uhm. theres actually some controversy about it? some are against it because of “more work” while others are for it to “finish what we started.” kohgas confused about the entire thing and while he knows how wreath survived he honestly doesnt know what to do. some yiga are actively mad at the clan because it now feels pointless or like theyd have to kill the hero Every Time. the monarchy isnt even action guys why bother . some are more vocal about it than others too, while others hide their disdain to be more accepted. others are actively joining the clan for purpose and to not be slaves to a day by day lifestyle, only to be slave to a day by day lifestyle because nothing is safe from that </3. others genuinely want to kill link, some hate him but question why theyre even. killing him at this point. so the clan isnt in shambles but its going through one hell of a time. absolutely No One knows what to do. it was actually more in shambles pre cal for a bit. it regained hope after calamity ganon rose but people are doubting it again now, especially because its been 100 years. but otherwise some are trying to kill link and rob people. mostly same as canon in that regard. maybe sprinkle in sheikah tech research or more actual. Studies about it. something something theyve clung to their roots far more than the actual sheikah.

also note about cado. uh. he’d be in absolute Hot Water if he was found out. hed be forgiven if they knew he was being threatened, but thered still be doubts about him and people would fear him really badly.

post . Everything. when zeldas free. uh things actually get back on track because i do want her to try and reinstate the monarchy. and while some things are good ideas (rebuilding towns and getting more houses/making areas generally safer) some are Not (REINSTATING THE MONARCHY AND A RULER CHOSEN BY DIVINE BLOOD.) focus changes from killing link to killing zelda; the ones who doubted killing link would fix or do anything moved on to killing zelda, while the other half worked on killing link. zelda has sheikah tech knowledge however, while not enough to rival the yiga she actually has some from when the monarchy exiled and hunted the sheikah, burying it but also taking a glance at it to make sure at the very least, it was Theirs rather than the sheikahs. most of her knowledge comes from studying the tech herself though, but terms and slang forgotten come from the previously stated monarchy things. so basically their knowledge collides and zelda would put up a fight against them. she can exploit their own tech theyd despise her for that. she also knows how to fight thanks to cado and. sometimes link. he doesnt train her a lot but he helps her with strength shrines and also helps correct her when need be to make sure she doesnt pull a muscle. thered be fights over whos easier to kill vs who Has to be killed.

she wouldnt manage to reinstate it and while they still go after her after that shes mostly safe while living in kakariko. i think ganon the guy would . Happen. after the reinstating the monarchy attempt however thats for later me to decide. basically its complicated. kohga respects however also fears and detests zelda. i dont think he hates her but he sees her as a bit of a threat. hes still silly though he isnt like a dark brooding “so the princess awakens…… mwuhahahahahaahaha………. once the blood moon rises Kill Her…. or else i will break your bones……….” or something hes just. “HOW IS THE PRINCESS STILL HERE????? SHE KNOWS MY SECRET TECHNIQUES. HOUSTON WEVE GOT A PROBLEM.” he sometimes goes to personally stop her but otherwise he just. half chills and half lives in fear. hes kind of mad about the monarchy honestly but once again its like “YOU HAD ONE JOB??”. not “cursed princess and her toilsome guy……………. that loathsome monarchy i will rule it” or something. hes doing his best </3. think of him constantly like. in a shinji chair pose. or that stickman reaction of a guy on his hands and knees crying. also. more tech afterwards. like the zonai tech however its the sheikah tech instead . study overdrive…..

uhhh yeah just totally normal things. :).

#wreath of the bild #TWO IN ONE!! BOWLING SFX #hello!!!! i think they study more tech after the calamity as its trying not to kill them now #uh otherwise? pretty canon

5 notes · View notes

regnantlight · 1 month

Note

⭐️ :D if you have any?

Relationship Builder Meme

If/when they ever hug, Zelda can’t help but notice how it feels similar to a hug from her father (general size aside they seem to have similar body types) thanks Daddy Issues

Zelda’s father wasn’t withholding any information from her when she asked why the Yiga Clan hate them—he’s simply ignorant. The most common written history of what happened dictates the story very differently than actual events. Zelda has to do a lot of digging in old, old archives to find more accurate recordings, which, as her and Khoga talk more and more, is exactly what she does. Zelda, who is very pro-technology, struggles to understand the old kings paranoia and begins to seek a way to re-establish a connection between the Hyrule family and all members of the Sheikah (Yiga included.) It is not initially welcomed on either side.

The Yiga Clan’s asassination attempts really have left their mark on Zelda. She’s had nightmares of them occurring, which increased initially when Khoga and Co. joined their war party. It’s taken a lot of work to put her emotions aside and focus on collaborating for Calamity’s defeat.

While Khoga and co are very vocal about not being “her people”, she does include them in her mental duties of “I must protect My People” because at the end of the day, they are still fighting alongside her, she is helping to command them in battle, and if they die, the blame falls upon her (or at least, this is how she sees it.)

She finds Khoga interesting and doesn’t not enjoy her time around him—but a part of her still expects him to try and hurt her. It’s a very odd position to be in. She tries not to dwell on the emotional conflict of it because there is a job to be done, but once the war is over, I think it becomes more difficult for her to ignore.

#headcanons #ENJOY ❤️

3 notes · View notes

ijustreblogcoolshit · 9 days

Note

oh also i forgot to mention in my last ask, what do the villains do in the au??

u mentioned that ghirahim tries to kill the links and ganon kidnapped him as a baby, is their goal just to take down/assassinate the royal family?

and what about other loz antagonists like vaati or majora or cia or the yiga or-

i’m getting too ahead of myself- no need to answer my questions all at once lmao

Nono dw, they're very good questions !

I was rambling about this to my friend a while ago and they joked about Ganondorf being a kind of mob boss, so I'm going with that kind of idea. It's a bit like how in oot Ganondorf pledges alliance to the royal family, but he plans to betray them and take over Hyrule- he is good friends with people in the government so they excuse his actions. He also pays them to keep quiet and silence victims when things get out of hand.

In this au, the Royal Family and government work hand in hand, so Ganondorf also fakes loyalty to them. His end goal is to break down the people until they're fully at his mercy and not able to fight back, then work his way up to having full power over Hyrule. The Zeldas are the only members of the royal family who can work mostly outside of his radar, which is why they're very significant.

As for the other Zelda antagonists, I feel like they'd be people working under Ganondorf who've sworn their loyalty and he's given them power, wheras the Yiga are basically his fan club who he finds annoying, but uses their loyalty to his advantage. He doesn't care for the Yiga, he mostly prioritises the other loz villains as in the games they play more of a significant role.

Like, Ghirahim and Zant for example; they're basically his sons, he trusts them the most so uses them for the more important tasks, because in sksw and tp the actual characters play more significant roles and are an active threat that shows up to humble the respective Link. But because of that, Ganondorf is constantly comparing them and uses one's achievements to belittle the other, so both of them are seeking his praise and favour, trying to break the other down to be the superior one. Ghirahim was kidnapped because it's a well-known fact that people in that family are typically incredibly smart and talented in their fields so Ganondorf wanted thag on his side. Zant willingly joined after being pissed off for being constantly rejected by everyone and just wanting to join the 'winning team' so that he could flaunt his power to those people.

For Cia, seeing as I'm fairly certain in Hyrule Warriors canon she commands an army and before that was in charge of timeline stuff, I'm gonna say she's a part of the Government overseeing laws and generally what people do. She's also working to train up an army of sorts with loyalty to Ganondorf, but most of them are Yiga Clan. She's grown to despise bananas now...

Ganondorf doesn't really play a huge role in Majora's mask, and there's nothing confirmed about the origins of Majora other than a small spinoff manga, so I'm not entirely sure about Majora's role. But taking inspiration from another modern au- Skyward Floored's incredibles au- maybe Majora could be more of its own thing who just works with Ganondorf as they share ambitions of power and world domination. Majora's more brutal, however, and deals with... enemies of Ganondorf, let's just say. This also has something to do with Time's facial tattoos...

As for Vaati, I'm not too sure about what role he plays in his games so I can't say much for him. But he does have a strong connection with Shadow, who just so happens to be Four's ex boyfriend who went missing.

They're all evil and irredeemable, but some character depth couldn't hurt right-?

Anyways, thank you for the ask !! I didn't mean to ramble for so long but have a nice existence lmao-

#tloz #lu #linked universe #rambles #modern au #thank you for the ask!#ganondorf #loz villains #i have no clue if this makes sense or not #I'm very tired but wanted to answer this before I forgot-

6 notes · View notes

rain-nap-write · 10 months

Text

I’m gonna set this idea here and maybe come back to it, maybe not. I don’t know how to make it short, so it would probably be long and I don’t know how motivated I am for that LMAO, I am still working on that Claude one! Anyhow, here’s an idea for a totk link x reader! (It’s kind of long). I like to come up with scenarios in my head when I listen to music, and this was one :)

Ok so,

In the events (early) of breath of the wild, you’re part of the yiga clan, but you’ve been having doubts because most of the continent is afraid of you. Trouble is, you’ve been there your whole life, you’re one of their important fighters, and the blood moon resets nature.

You were technically involved with the recent events between the yiga and shieka, but you and (can’t remember his name but the guy in kakariko who has two kids and left the yiga) we’re in kahoots, and you did everything you could to protect his wife. She knew that, and urged you to stay quiet to protect yourself. This was another thing driving you away from the yiga. But how were you supposed to abandon everything, where would you even go? You loved these folks and you didn’t think the shieka would accept that you had a change of heart, even if (the dude’s name) vouched for you. That might even get him in trouble!

So for now, you’ll stick it out.

When link first gets off the Great Plateau, he has an encounter with you. You beat him and he’s not really fighting you back, so when you’re over him and hoisting a weapon to lodge in his throat, your hesitancy that has built through the battle finally takes hold. You’re kinda like, “Wtf?? Why aren’t you fighting back??” He answer back like a, “I want to help people, not hurt them.”

After that, you can’t really find it in your heart to kill him. You even give him some healing potions and take him to dueling peaks stable (in disguise) and point him towards kakariko. Tbh you’re kind of worried about him.

The next time you’re sent to fight him, he’s on his way to zoras domain to take on the divine beast and you pop out of the sky. You didn’t now it was him, since you were just sent after a guy sparking some Link rumors among the yiga. You also didn’t know that you popped up between him and a battle between a monster encampment. Taken off guard, you were struck from behind, but you fended them off the best you could, given that you are on the verge of a blackout. Link helps you and gives you some healing stuff this time. He asks you if you’re going to hurt him (he recognizes a mark on your mask) and stares at you, waiting for an answer. After thinking about what to do, you answer no.

You even decide to help him. While you’re not ready to drop everything and join him (yet) you will make him a charmed necklace. You make it, and let him know that it will ward off the tracking of the yiga, honing that knowledge, and if he’s in danger or not, to you alone so you can come when he needs. (He’s gotta hide it, so that if the yiga in disguise catch him, they won’t catch on).

He finds out after he reaches the Zoe as domain, that if he thinks about you really hard, you’ll be summoned. You think he’s in danger, so you get kind of annoyed when he does this (he does it a lot on his way to the next divine beast, he is lonely and sad. Plus, you’re kind to him. Even though you get super annoyed bc you never know if you’re about to get hit or watch him roll around in the grass or smth).

At some point before the second divine beast, he stops in a field of dandelions and thinks about you really hard, wanting you to enjoy it too :) Of course, you pop up and start your little half hearted annoyed rant, but you stop when you notice him. He’s just been looking at you with the sweetest smile on his face, even though you’ve been kind of upset (not really, you love when he calls and he is very smug about knowing this). It literally makes your heart ache.

You tell him that you want to join him, and leave the yiga (but if he goes to kakariko, you’ll be at dueling peaks (until you eventually reconcile) shaking in your boots). Link is so happy, you think you’re going to have a heart attack. You tell him you’ll be back by night, you’ve gotta get your belongings and make sure it’s untraceable, maybe fake your death. He’s got a smile from ear to ear and he’s excited to have you along, nearly tearing up as you teleport away.

Little did you know you would not have to try faking your death, as you’re getting jumped by the yiga as soon as your sigils show up. Everyone is acting weird and so you decide sooner rather than later, and grab your stuff because your spider senses are tingling. At that point, you notice something’s about to go down and you’re sprinting for the entrance. You don’t want to fight these folks, they’re your family. Or, they once were, years ago. Anyhow, you’re dodging left and right until you’re in the lil canyon spot and get confronted by kohga and a bunch of blade masters. You take them on, but you’re pretty wounded bc a bunch of more advanced foot soldiers had also caught up.

You do your best to get their unconscious selves next to a fire in the canyon because the sun is going down, and you can name these people (you don’t want them hurt). You drag yourself to the bazaar and they help you heal up, a few of them saw the fight and were grateful (not knowing the story) and you return to Link.

Link was taking down a lynel, trying to build back up his skills after struggling with the polymus one. He spots your sigils and gets a little freaked out because of the situation you’re all about to be in (even more freaked out when he catches the state you’re in). You help him out a little, as best you can, and he’s making sure you don’t take more damage (while being careful himself. he only earned a scratch, which you fixed up).

You share a heart to heart, and it’s kinda romancy. You share a bunch of those throughout the botw events, and heartwarming moments. Also several “oh no! One bed!” Moments. But you don’t get together until after Zelda is safe. Link is a sap but he’s got goals (I say as he was romancing you the whole way).

ANYHOW, TEARS OF THE KINGDOM! SO,

Y’all are adventuring the castle, and the Gannon event starts happening. You’re sprinting for Zelda and grab her hand, but you’re both shoved off by Gannon attacking Link. As you’re falling you squeeze Zelda close to you and are getting ready to pull out a glider or teleport, when y’all are pulled back in time.

You’re kind of there protecting Zelda (in link’s place instead of beside him 😔). The day the memory happens where Sonia is got by gannondorf, you happen to catch him just before he gets there. You’re strong and skilled, but you’re no triforce wielder, and you don’t have the sword. But, he sees potential in your strength, and sees the magic that you possess (yiga stuffs), so he’s holding you by the throat and goes to the spot behind Sonia. You can’t even brush your feet on the floor, and you’re helpless as it happens. Zelda is trying to figure out what to do, because you’re held hostage, but Sonia needs immediate assistance. You’re waving at her to shoo her away, signaling that you’re ok (not true lmao). So, when rauru comes, they make their escape. (POV: Link watching in absolute horror)

Gannondorf drags you to wherever the chasm is and figures he can use you as an amplifying power source (like a horcrux prism or smth). He uses the tear on you to kind of make you suspended in his malice in an everlasting state of giving and taking power from you. You are where most of the never ending malice comes from, even while he’s sapped dry, for him and the other gannons. (It’s kind of like when aang is in that water monster thing, but gone completely wrong). But because of this, you are able to be mindless through eons of time (took inspiration from the Zelda dragon).

On his way to the second or third sage, Link is exploring a chasm from a well in some ruins (pretty close to the korok forest maybe?) and comes across a being of malice chained to the floor. It had been shunned by the light for all of these years, stuck in the darkness far underground. It put him on the verge of tears to look at it, but he wasn’t fully sure why. Maybe a part of him knows that this is where you ended up. The dark to contrast Zelda’s light.

As he’s fighting you in malice and chains, he’s created an opening. It is one that the malice flowing out of you is quickly trying to cover, but not quick enough. Link got you out of the being that was suspending you. a cord of the malice was still attached, and with watery eyes, he quickly separates it from you using the sword of light. With bated breath, the hero checks for signs of you being alive, and upon confirmation begins sobbing. The tears that had welled up were cascading freely down his cheeks as he cradled you close to him. Much of the malice surrounding y’all (along with your malice suit) and in the chasm, and some in the overworld, is gone now.

All these months, he felt he had been staving off insanity. He went from living a mostly normal life, surrounded by the love of friends and of you, to being completely alone, fighting for ghosts of the past and the future in the blink of an eye. He had seen you through Zelda’s memory, watching as you and the others no longer partook in those, one by one. He longed to see the both of you again. Link begged to embrace you in his arms night after night.

Finally, here you were.

Link stopped everything when he felt a hand on his cheek, softly brushing the tears away. He looked down at you, and only began to cry harder. You were crying too now, as you fully embrace him.

The two of you then go on the adventure to save Zelda again :) it would def have bits of romance, but I fear writing it would be repetitive (only because it’s me. If someone else did it, it would probably be fine. I think maybe I would have to make it after he has the sages, then he gains you and fights Gannon. Maybe even after he saves Zelda!)

#link x reader #totk #totk spoilers #botw #botw link #totk link #x reader #gender neutral fanfic

9 notes · View notes

skyview-temple-spring · 1 year

Note

I had this sudden thought a while back but I'm too much of a coward to say it publicly so here it goes: People who blindly blame Hylia for what happened in the Zelda series would've joined the Yiga Clan if they were real. Do you agree of disagree?

Oooo so my first thought was ABSOLUTELY but thinking about it more a big part of the Hylia hate comes from a desire to protect Zelda (and to some extent Link). I think there's two types of Hylia haters: Ganondorf apologists (excluding ones that try to rework his character because of the racism—it's usually fans that act like they're doing the world a favor with their rehydrated sex icon in a different flavor of divine right to rule monarchy and end up furthering different stereotypes) and BOTW Zelda apologists. Zelda did nothing wrong ever and the fact that her powers didn't activate is not her fault at all 🥺 disregarding the message that her own insecurity was what was holding her back, that Hylia had nothing to do with whether her power unlocked or not... I could get into the analysis of Zelda's almost entitlement that she deserves her powers simply because she's the princess (an idea forced on her by the king, yes, but one she does not question)

But that's not the point of your ask asdfgjkl.

So, Hylia haters joining the Yiga—yes and no. Those specific Ganondorf apologists absolutely, because they often think they're doing something groundbreaking by reversing roles and making the "good" characters "evil" and vice versa, which doesn't address the issues with the good vs evil black and white mentality of LoZ. They're the ones that try to spin the cult as good despite their desire to destroy Hyrule and surrounding territories and the horrific things they do to members who want to leave (same vein as fans that try to excuse Ghirahim, btw, by taking away his agency and making him totally under Demise's control against his will despite his canon inclination towards loyalty and desire for violence for the sake of violence (but he's too good for that, which is why he can't take his anger out on Link, no, he has to send minions and bosses after him. Very Roman senator watching gladiators fight to the death for entertainment while simultaneous denoting them as the lowest of the low in society))

BOTW Zelda apologists, no, because a fundamental part of the Yiga is the hatred of Zelda and Link and all things Hyrule.

I know the Yiga are BOTW specific, but it's interesting that they are the cult that gets attention. The Yiga are to the Sheikah as Zant is to the Twili—people make Twili OCs, but they're rarely Zant followers, and when they are, they're portrayed as evil/grey and corrupt in tune with canon. With SwS and BOTW being the only games to canonically include Hylia (this might be wrong, I know some games like Triforce heroes (?) came out between 2011 and 2017) it makes more sense that Hylia doesn't affect this but with the fandom's tendency to put Hylia into story lines she wasn't in to begin with it you'd think they'd receive the same treatment. I don't like Zant though and never really did so maybe I just never saw that happening

#tw racism #ask #anon

16 notes · View notes

kapncrunch · 1 year

Text

TotK Zonai and Sheikah Headcannon

Hey! I'll be spit-balling here so excuse me if it's a bit jambled.

My personal headcannon is the Zonai were a powerful tribe that existed alongside the Sheikah tribe. Zonai were described as powerful and barbaric, while the Sheikah were described as very intelligent. Maybe the differences in beliefs and values caused the two to fight? Power vs. wisdom has been a very common theme in the series. Since the Sheikah had the support of the royal family and goddess Hylia, they may have been able to force Zonai into undesirable terrain. The areas inhabited by Hyrluians and Sheikah were towards the middle of Hyrule in BOTW, so it is possible the Zonai had to travel around the middle to avoid conflicting with the Sheikah. This could explain why their architecture can be found in the corners, Faron, and the dark area near the lost woods. However, there are suggestions that the Zonai and Sheikah collaborated, with many Shrines being found in Zonai-built architecture. This could be the two tribes coming together after seeing visions of the future, or it could be the Sheikah building Shrines after the Zonai had lost power/died out. In addition, it looks like they came together to sealed gannon in the temple. There is very little information about the Zonai, so maybe the Royal family was purposefully hiding information about them. They could be tied to a massacre that the Royal family wants the rest of Hyrule to forget.

I have another theory that the mysterious figure shown in the trailer is the Goddess that the Zonai, Twili, and Gerudo worshipped. This Goddess could have given these tribes access to 'dark' magical knowledge. Since this Goddess was unfamiliar to the Hylians, they may have labeled her as inherently evil. In addition, most of the tribes who worshiped her came into conflict with Hylians at one point. I don't think she will be a villain in TotK. I think she (or her reincarnation/chosen one) will serve as a guide to Zelda and Link.

I think it would be fun to have a character who has narrative parallels similar to Zelda be the reincarnation of the other goddess. I imagine her as a former member of the Yiga Clan who's father is Sheikah and mother was a deserted Gerudo warrior who joined the Yiga Clan. She learnt ancient and forbidden forms of magic and knowledge from her parents, but once the tribe fell apart, went to explore the ruins in the Faron region and discover herself. Her personality would be rambunctious, curious, and intelligent, like a trickster. Her personality/journey could serve as a contrast to Zelda's, came from an evil tribe, dark magic came very naturally to her, was allowed to research ancient technology from a young age, confident and rambunctious, etc. She could help Zelda and Link to learn about the various ruins and unfamiliar magic. Her and Zelda could be seen to represent the dragon circle seen in the trailer.

I tried drawing her but gerudo and sheikah fashion DO NOT mesh well so her design turned out bad >< I'll try redesigning her later

#totk theory #zelda #legend of zelda #sheikah #zonai

12 notes · View notes

linksthoughtbrambles · 2 years

Text

[Animals can think and echoes can be merciless.]

Part 8 of Adventure Log+ (Sequel to Link’s Thought Brambles. I highly recommend reading in order! Edited 9/30/23 to tighten language.)

[Note: A big thank-you to @embyrinitalics for very generous help on horse behavior and resources about it!! 😀]

-----

“Princess?”

“A moment, Sir Margil.”

Yeah. I wouldn’t’ve let my sister come if I thought it would be like this.

No, never before.

It is odd.

“It won’t do.”

“What won’t, Princess?”

Maybe they were hoping I’d be dead and the Princess vulnerable? Still… they weren’t on our direct path…

“I agree with Link. I cannot abandon people who may be in need of help.”

I mean, the one we usually take to the lab. Nearby, yeah.

“…Yet… we have two sticking points.”

If it was about us, though, they’d have to have been talking to someone from the Yiga clan.

“What points?”

Yeah, I didn’t think they could talk, either. Or understand us.

“One—Purah expects us. If we fail to appear, we’ll cause a panic.”

True, no funeral. Just a glad-you’re-not-dead party.

“Two—you, Chee.”

Maybe the bokos can’t tell the difference.

“I’ll listen to you. I’ll run if I have to.”

I don’t know. You’d think they wouldn’t want to draw too much attention to themselves.

“Indeed. That is, in fact, exactly what I’ll ask you to do—immediately.”

Ahadis would’ve sent a team out to clear the plain-

“Now?!”

-within a day or two-

“Yes.”

-if they attacked the farmers.

“…And not alone.”

…Right?

“Sirs Margil and Beraya, please accompany Chee to the lab.”

“Wh-“ “Princess-“

“My mind is immutable in this. Chee is many times more vulnerable than I am.”

Yeah, I- guess- I don’t know Ahadis that well. Jeralt would. The king would, too.

“…Link’s gonna be upset.” “You’ll have no backup, Princess.”

Yeaaaah, he is kind of, isn’t he?

“Indeed—but I have my bow. The plain is wide, flat, and we know Link is on this side of the further ridge.”

Hah! I kind of figured that’s why he joined the melee.

“I shall see anything coming, and likely eliminate it long before it reaches me.”

“…Link’s still gonna be upset.”

…Sorry, Daile.

“Indeed. But if you ride hard to the lab, you can tell them what’s happened.”

No, I mean, you were just smiling and now you’re not, so… oh s@#$.

“They’ll send help.”

It’s Wenn, isn’t it?

“You’ll be safer, and so will we in the long run.”

You’re good friends, right? And he joined.

“It seems to me as though if you encounter any riders in your direction, you ought to push forward—don’t engage unless you have no choice.”

Well, no, Jeralt said so.

“Yes, Princess.”

It’s one reason he recommended you.

“And Chee—you ride on no matter what.”

That and your skill, which he was obviously right about.

“Y-yeah. Okay.”

No, it IS important.

“On, then. Quickly!”

This… with what’s coming-

“Yes, Princess.” “Yes, Princess!” “Please tell Link I listened?”

-we all need to be…

“I shall. Now, go!”

(Whyyyy did I dig myself into this hole?)

“Hyah!” “Hup, boy.” “Go, Snorts.”

Daile… allies are great, but allies might not be enough.

“Well, Tass. Onward. Hurry!”

We all need to look out for each other. And I did NOT mean to be a dick and insult your friend. I was joking. Badly. About Ahadis. Which… is no excuse. I apologize.

Nope, my fault. Careless of me.

I wouldn’t’ve put him on the Princess’ guard if I was holding a grudge. Same goes for Farniha. Haha, and she kneed my fricking groin and backhanded my face. It… hurt. A lot.

O-oh. Yeah, I’m not surprised. I’m glad they’re following us for now. If the Princess has us turn around to check up north, the horses might lead us right to where they came from.

Aaaaand Daile’s gone silent.

Goddess dammit Link, you dumbass. He and Wenn must be very good friends for him to have gotten that obviously pissed off or upset or whatever that not-good face on him was.

Do NOT criticize people’s friends.

Not that I did on purpose, but I should've realized about Wenn.

We worked really well together in the fight. Hope I didn’t ruin it.

Link? If you’re going to be a leader and not just a bodyguard, you need to step up your people-reading skills. You can’t be in a meeting or something and rely on Zelda to turn to you and say, ‘Link, you’d better not say anything critical about so-and-so, because other so-and-so is other other so-and-so’s friend and you’ll tick them off, my kind but socially-inept consort.’

…I don’t think she’d say that in public. Especially the ‘consort’ part.

Having the slate read her mind would be so tempting, wouldn’t it? I wonder what she DOES call me in her thoughts. Does she think ‘Sir Knight’ and things like that a lot or is it more like, ‘hmm Link likes it when I call him Sir Knight so I shall do so at every opportunity’?

Next time we’re completely alone, I’m going to ask her.

If I remember.

Which I have not been so great at, lately.

Lots of notions. Not much acting on those notions.

There are too many notions.

Slow your brain-babbling down, Link. Somehow. Maybe… picture slow-moving things. Like snails! Yes! I can focus on an image of Nails ooooozing his… or… her… way along those nice long dandelion leaves in his little snail-house. That’s slow.

He’s cute.

How long do snails live?

Oh no. I hope they’re not like flies and things. I don’t want to find him dead in there when we get back to the castle. Zelda probably knows what to expect. She’d’ve warned me, right? She would’ve said something if he could conk any second.

If he does die at some point I’m going to have to catch a new one and put it in there, because if Myrri sees an empty terrarium she’ll be upset, and most likely she’ll yell at me and/or kick me in the shins for killing him.

Nah. Not after her mom.

What… what happens if that field Fi saw at the castle really is the Calamity?

If… it’s already here, and just biding its time for some reason?

Is it waiting for some perfect time to strike?

Those copies of the old tapestry show it being in the middle Hyrule field, though, not at the castle. Like, showing up at the dead center of Hyrule. Right at its heart.

That was 10,000 years ago, though. I guess… could it have moved?

It talked to me. It did.

It… HE talked. It sounded like a man.

No, not a man, exactly. Male. Monstrous. Loud. Like nothing else I’ve ever heard. Like the deepest growl formed into words.

It talks.

It… thinks.

I thought, before, it was just like… some sort of… animal. It LOOKS like an animal in the drawings.

Even animals think, though. I bet that fox Mipha saved never went anywhere near that Hinox again, no matter how much it wanted to drink from that pool.

Rionee knows me and loves me and knows how to avoid snakes and thorns… and she knows when I have apples even when they’re hidden from existence in my Korok pouch, because she knows me, and I must have a tell. She knows how to get me to give her chin scratches, and she knows how to get the stablehands to give her treats even if I already gave her some, hehehe. Don’t you, girl?

She knew I needed her to be quiet before attacking those bokoblin riders.

So… even if the Calamity were just an animal, it could think. It could learn.

And it’s NOT just an animal.

It’s smart. HE’s smart. He’s… vengeful. He hates me.

Try to remember, Link. What exactly did it- HE… say?

I am able to assist you in this if you wish, master.

Fi? You can do that?

Yes.

…Yes. Please.

It will be unpleasant.

Yeah… but it might also be important.

Ready yourself, master.

‘Settling for this psychic amplification… it’s…’

MmMM!

‘…paltry… compared to the suffering I’d like to inflict.’

HHGHH!

‘To see you bound… helpless…’

AAAH- HHH!

‘…while I trace you with my blade… like a lover’s caress… opening you from neck to groin… and removing your organs one at a time.’

NNN-GGHHGHHTTNGG-!

‘I long to see the horror in your eyes… I'd start with your intestines, I think.’

HKKTT- KKTT-

‘Just slice them free at the bottom -and pull them out an inch at a time.’

HHHHGG! HH! HH!

‘…It’s my one regret.’

M-AAAH!

‘You’ll be dead before I emerge.’

PHH- PHHH-

‘I’ll never see your face contort as I rearrange your innards.’

KMPH-

‘I’ll just have to rearrange hers instead.’

MmnNNNNN-! DEAD, YOU’RE DEAD, ASSHOLE! I DON’T CARE WHO YOU ARE YOU JUST F@#$ED YOURSELF HARD YOU THINK I’LL LET YOU TOUCH HER?!? IF I DIE TODAY I’LL F@$&ING HAUNT YOU AND YOU’LL STILL LOSE!!!

‘Ah hahahaha. There it is. So predictable.’

WOAH! Holy- holy S#@$-

Oh! Daile- yeah. Yeah, I’m fine. It was Fi. She showed me something.

It was when the Calamity went after me. While I was hurt.

No, it actually attacked me.

No, no, it’s not like it’s running around the castle, it went after my thoughts. It was in my head.

Yeah, it is… creepy.

No, I couldn’t see it. I heard its- sorry, his- voice, and it made me… hurt.

We think he was trying to make me strain and bleed faster, among other things.

You can ask anything you like.

Oh, no I hadn’t finished talking to her.

It really is okay-

Alright. I can talk out loud to her. I know you can’t hear her but at least you’ll know my half.

No. We’re all in this together.

Okay.

Fi, that memory- it’s like I was there.

You were there, master.

Yeah, but, I mean it’s like I was there AGAIN just now, actually inside the memory. Living it again.

As I said, I may assist in these endeavors. I experience everything you do when we are connected.

So, do you remember everything perfectly?

Usually, but I may access any of your memories, master, even those which occurred before you reached me.

Wow.

You are correct in your assessment of the Calamity’s intelligence. He is no mere animal. He is extremely intelligent and cunning.

He also hates me. And he hates the Princess even more, doesn’t he? Oh- Daile- I mean the Calamity.

…He does hate you both. He would like little more than to see you both utterly destroyed. The creature you now call Calamity Ganon has had other names. Ganon. Ganondorf. Demise. They are all the same being, once driven by the pursuit of power. Now… I no longer know what drives him. Perhaps it’s the same, or perhaps he simply seeks the death of all who will not serve him. It may even be that he wishes nothing else but the destruction of our world.

…Why?

I’m not certain anyone has ever known the answer to that question. Even he may not.

That memory just before shows he doesn’t just want us dead. He wants us to suffer first. He wants to watch it happen. He doesn’t want us to die right away.

…Yes, master.

But… if he were really HERE here, there’s no way he would’ve let me survive that injury. The only thing he was able to do was scare the crap out of me and amplify the pain I was already feeling. He’s not really here yet. He can’t be, or I’d be dead.

That is logical.

So, it’s more like he has a window he can look at us through. He can’t actually get in the house.

That isn’t a terrible analogy, master.

…Thaaanks. It might not… actually be at the castle, then. It could have nothing but that window to us. Something he’s looking through.

It’s possible.

You don’t sound convinced.

There is not enough evidence to make a determination.

Okay… so… what makes a window?

Master?

If the Calamity has a window to look through, why does it have it? Like, did he make it? Did someone put it there? You yourself said the field around the castle was probably not the Calamity itself, right? That it’s a spell?

A magical field, correct. The field itself is most likely not the Calamity.

Can I ask you how you figure that?

It’s based on my observations of the properties of his previous incarnations. He never emerges identical to his previous form, but he is always recognizable as himself. I did not ‘recognize’ this field.

So you said the field could be for communication.

You said that, master.

But you thought I was right.

I concur with your logic.

Great, so… what if the field is just the window? The Calamity is… somewhere. Maybe not even in Hyrule at all. And the field is what’s letting him see?

And speak.

…Yeah. Like yelling at someone through the window. Not easy, but you can do it.

Fi?

I am processing.

Processing what?

Information.

…Yeah, I figured that, but-

Please allow me some time, Master. I am sorting various information regarding the Calamity both 10,000 years ago and in this age, including words I have heard spoken in your vicinity. Once that information has been sorted by priority, I will project various scenarios and present probabilities of their likelihood to you.

W- how long will that take?

Longer each time you interrupt, master.

…You’re such a snark.

Like master, like servant.

Y- you’re not my servant-

Interruptions, master.

…Sorry.

Yeah, she says she’s processing.

Not sure. She usually doesn’t take long to spit numbers at me. This must be a big lift.

I have so many questions, Daile, it’s not even funny.

Oh! Yeah, those sword-beams were pretty cool. I had no idea she could just do that.

The thing at the melee was different. I had to concentrate on those.

She says as long as I’m completely healthy, she can just do that.

I KNOW!!

Nope. Didn’t know until those bokos today.

Guess I just have to wait.

Hphhhhh.

These poor horses were scared. I can hear that blanket-blue roan grinding her teeth from here.

They look healthy, so the bokoblins didn’t have them long. There’s no way they were wild. They fell right in line with us. I could probably ride one of them bareback since Rionee’s hurt, but it might confuse or spook the others. Not worth it unless Rionee starts to feel tired.

Your head still feeling alright, Daile?

I’m glad.

No, it’s not bad. Just a shallow gash.

I’ve gotten worse fighting them. One time, a silver snuck up on me in the woods and threw a rock at my head. It got me good. Lucky I didn’t conk out.

The silver ones are smarter than the others.

Damn, you never fought a silver before? I’m even more impressed.

You didn’t get killed. When silvers are involved… most… most people do.

Granted.

Yeah. Hateno.

My father did try to clear them out, but he was here a lot.

A few times a year.

He never wanted us at the Castle.

Don’t know why.

No, I usually just went after them myself.

Because they’re evil bastards.

Moblins show up there, too, but not as many of them. Usually further from the village. They pop up to the west past Ginner and Midla woods.

As far as I know, no one’s figured it out yet.

A lynel? No. No, thank Hylia. Not near Hateno. I’ve never even seen one.

Lizalfos, yes. You?

Good.

Wow, Link. Daile’s dad’s seen some nasty s@#% you haven’t.

…Daile was a good choice.

I have to officially thank Jeralt for suggesting him.

----

There they… are?

“Link--ohhh. Alright, Tass. Ease up.”

Daile, do you-

No, I don’t.

Did they get attacked too?! Zelda’s riding pretty quick. She’s upright- Rionee, girl, I know you’re hurt but-

She wants to rush. I shouldn’t be surprised. The wound wasn’t so bad.

I think she’s grown attached to Tass. Which… is awfully sweet.

Why is it only Zelda?

My Goddess. Chee!

No, no. It’s fine. It has to be fine. She’d be at a full gallop, wouldn’t she, if it wasn’t?

…Unless Tass is hurt.

That could be.

He’s too far away to tell for sure. His gait looks normal.

Yeah, I don’t want to shout. Just in case there’s anything listening. Seems all-clear, but… just in case.

Tass is so huffy. I think if he was hurt he’d make sure everyone with an eyeline knew it. I’d expect lots of tossing his head around and loud whinnying.

I agree.

Almost there.

She’s not shouting, either.

I feel like if she had bad news, she’d be yelling it at this point.

Fingers crossed.

“LINK!”

Ah. In that case- “PRINCESS!”

“EVERYONE IS WELL!”

Oh, praise Hylia. Praise…

Maybe I do understand why father wouldn’t want us around. Maybe we’d worry him too much.

Heh. The horses. Nickering. Good.

…Tass is so rushing here to nuzzle-nose Rionee.

Aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaand there it is!

Awww, you guys are so cute with your attention-ears and nibbly-wiggly lips and I’d like to greet Zelda the same way, but I can’t pivot my ears like that-

“Hello, brave sirs.”

That tone! Wish I had the luxury to melt. “Heh. Hi, Princess.” Melting right into her arms. That would be ideal. Can't right now. And... blushing. Cut it out, face. I said stop.

“I’m glad to see you both look only slightly worse for wear.”

“Thanks.” “Thank you, Princess.”

The way she’s looking at me. She was worried.

She still did what I asked, though. Strong, her. I don’t know if I’d’ve had the willpower to stay put.

“I sent the others on to the lab.”

“That… does make sense. That is, if- are we heading north, now?”

“Yes. I do expect Margil or Beraya—perhaps both—to ride back at speed with reinforcements.”

“It’ll be a while.”

“Yes. I’ve been watching the slate.”

Oh. A… lot went through my mind since we split up.

“Will the other horses lead us to their homes?”

“If we turn around, yeah, probably.”

“Let’s do so. I cannot turn my back if my people need help.”

That’s it then. We turn around. We wait. See if they start moving. “We… may not find anyone alive.”

“I know.”

They’re grazing. Makes sense.

"Let's take the chance to rest the horses. They'll need it."

Zelda and Daile dismounting, too. Good.

Everyone gets a breather for a few minutes, at least.

…If anyone bleeds out just minutes before we arrive, I’ll be pissed at myself. But the horses need some time. If they don’t stop soon, I’ll give one a quick whack on the behind and see if it keeps moving. Not the blanket-blue. She’s toothy.

-----

By the most holy light of Goddess Hylia.

“Wh- what happened here?”

So, Daile’s never seen this either.

Don’t be an ass, Link. So you’re not the only confused one. Who cares?! If Daile knew, you’d have a leg up!

As it is…

As it IS…

What the f#$% is that?!

What’s that sound-

Zelda. The slate. The camera. Of course.

She’s swallowing hard.

“L-Link. Do you have any knowledge of this?”

“No. Fi?”

I am processing. Do you wish me to pause?

For this, yes. Please.

Very well, master. I will comply.

The substance in question is malice.

…Malice?

Yes. I have encountered it in several ages. Do not touch it.

“Fi says it’s called malice. She says not to touch it. What happens if we do?”

It will harm you.

“It’ll hurt us if we do.”

“A name helps little. What IS it, Fi?”

I do not know all of its properties, Princess-

“Sir Daile- here- you may-“

“Thank you, Princess.”

…I can tell you this much—its presence does not necessarily require proximity to the Calamity. I encountered it once with my first Hylian wielder before the First Seal had broken, and at an entirely different subterranean location. The substance in that case had contaminated a once-pure water supply. It may also solidify and become crystalline. Though I have no information on the mechanics, the substance does appear to be linked to reanimation.

“What do you mean reanimation?”

The restoration of a corpse’s ability to move about independently.

“What?”

Forgive me, master. I recognize this information is disturbing. Please approach with extreme caution. Typically with reanimation, destruction of the head is necessary to put the construct down.

“Wh- construct? What-“

Apologies. I refer to the reanimated creature. It no longer lives, master. It is… a reconstructed shell. Nothing more.

Reconstructed shell.

“Zelda.”

“Yes.”

“We have to dismount to check the farmhouse… and the barn.”

“Yes.”

“Draw.”

“Yes.”

Her arrow nocked already.

Daile’s went with the bow, too.

You’re on point, Link. Sword.

I… can hear it. That malice stuff. Bubbling, oozing… Like hot mud. The color! Not remotely natural, that. Changing. Purples, pinks… hot-bright, like fired-iron but the color’s all wrong. No blade looks like that when heated.

And it’s moving. The surface just… just… flexing. Like… living, liquid muscle.

Dear Goddess. This reminds me of something.

It reminds me of something, and I don’t even know what it is.

It scares the ever-loving begoddess out of me.

…Grip your sword, Link. Grit your teeth. This was a farm. There could be people in that house. People who need you-

Someone’s moving, the sound- walking, shuffling, dragging feet, they must be hurt! Speed up, Link- they’re coming out close to that stuff-

HH!!!!!!SCREAMING-

“HH!” “UF-“

SCREAMINGSCREAMINGSCREAMINGSCREAMINGICAN’TMOVE WHYCAN’TIMOVE MYGODDESSWHATTHEF@#$ISTHAT WHATISIT MYGODDESS MOVEMOVEMOVEMOVEMOVELINK! MOVEMOVEMOVEMOVEMOVEMOVEMOVE OHF@#$IT’SCOMINGCLOSER NONONONONONONONONONONO MOOOOOOOOVELINK!! MOVE MYGODDESSITSDEADITSDEAD WHATEVERITISITSDEADITSDEAD-

Cease, master!

FIFIFIMYGODDESSLOOKATIT

Do not concentrate on the fear!

ITWASAPERSONAPERSONAPERSON

It is amplified! Hear my voice instead!

FIPLEASETELLMEITWASNTAPERSON

Will yourself to move! NOW, master!

M-MOVEMOVE MOVE MOVEMOVE

Will your muscles to!

MOVEMOVEMOVEMOVEMOVEMOVEMOVEMOVEMOVEMOVEMOVEMOVE

Persist!

MOVEMOVEMOVEMOVEMOVEMOVEMOVEMOVE- FREE!

Attack, master!

“TELL ME IT WASN’T A PERSON!”

…

“FI, FOR F@#$’S SAKE, TELL ME IT WASN’T A PERSON!”

Master, do not delay!

“TELL ME!”

It will close and stun you!

It’s SLOW, Fi, I’m BACKING OFF, now “F@#%ING TELL ME!”

WH-?

An arrow in its eye- two.

It’s on its knees.

The merciful thing is to remove its head, master.

You can’t be-

Three arrows.

Four.

It’s down.

Not moving.

I don’t- I don’t think it was breathing even before.

Hard breathing. Zelda and Daile. Behind me.

My breath, too.

“Fi. Fi, what-“

“LINK!” “ANOTHER!”

??!?!!!

No screaming this time- no screaming- what- what’s it doing?

Oh my Goddess.

Goddess. “Zelda-“

“I see it.”

Fi. Fi, in the name of Hylia, please. Please, I’m begging you, tell me those aren’t people.

…

Smaller than the first. Slighter. Was the first one a man? Is this a woman?

…A husband and wife?

Fi, why won’t you answer me?

I cannot tell you what you want to hear, master.

My Goddess.

My Goddess, it’s curling up. Fetal position. Like it’s crying. Mourning.

Mourning the other.

It will not remain this way for long, master.

The merciful thing is to take its head.

“Link.”

“…Zelda, I- Fi, is there a way to save them?“

There is nothing left to save, master-

“Horses#$@! If there was nothing left, it wouldn’t do that!”

It is an echo, only. It is dead. By slaying this form, you would free its body from imprisonment to another’s will. It is rest. It is mercy.

“I- I don’t know if I believe you.”

Then believe IT, master, for it rises.

Hylia help me, it's SCREAMINGSCREAMINGSCREAMING

DO NOT PANIC!

S@#$ITSTHEEYESORTHESOUND

KEEP PRESENCE OF MIND!

ITSASPELLORACURSE

Magic, yes! You are stronger-

MAYBEBOTH

-will yourself free!

MAYBETHEY’RETHESAMETHING

Move!

CLOSERCLOSERF@#$

Move, master!

F@#$!F@#$!

MOVE!

HOLYHYLIAMYNECKMYNECKPERSERVEUSLIFTUSFROMTHESESANDS

Yes, prayer!

KEEPUSWITHTHEDAWNINTHESELOFTYSKIESMAKEOFUSATEMPLEOFHOPE

Hope!

GODDESSGODDESSGODDESS

IGNORE fear—MOVE!

ISTILLCAN’TMOVEMYNECKMYNECKHYLIAPLEASEPLEASEPRESERVEUSLIFTUSFROMTHESESANDSKEEP

“AaaAAAAAAAAAH!”

Zelda! OFF“AahhH-HHNO NOT HER!" THROUGHITSNECK THROUGHITSNECK“NGH!” S-sweet skies, what-

End it, master!

Blade- right THROUGH- my- my Goddess its eyes are on Zelda and she’s stuck. Stuck. But it can’t move with my sword through its neck.

How is it still alive?

This is un-life, master. End it.

I can. I can. Yank the sword back. Through its spine.

I can.

Just… Do it, Link.

Come on.

Just do it.

“Mmmh. Hh-hh-“

Slice.

Ribbons.

“Mmpgh-hh-Link. Link!”

Zelda.

“Link—Link, answer me.”

Zelda.

“Link?”

That’s Zelda.

“Link, stop looking at it.”

Zelda.

“Stop, Link.”

She… she blocked it.

Good, that’s good. I don’t want to look. Not at its… head… hanging… off…. Like that….

Ribbons.

Sinew. The inside. Of a. Windpipe.

A person’s.

The wound, she’s-

She-

Doesn’t she understand?

Doesn’t she know what I just did?

Doesn’t she-

Doesn’t-

“Oh- Link-“

oh- oh, no- “mmMMbkhhhh-“

“Turn away-“

“Hhhhhhuah-“

“It’s- alright, just-“

“hhhhhHHHUAH-“

“Just don’t look-“

“HHH- HHH- HHH-“

“Th-there…”

“Hh-hh… hh-hh… hh… hh… hh…”

“A- alright?”

No. No, not alright.

It’s a good thing I hadn’t eaten anything in a real long time. There’d be a mess. As it is, I just doubled over. Made noise. Not dignified. Not. Not.

Aren’t I supposed to be some kind of hero or something?

She’s rubbing my back.

Daile heavy-breathing.

I’m not the only one massively freaked out.

“It’s okay. It’s okay. It’s dead.”

“I- it’s not that, Zelda.”

“…I know.”

“Fi wouldn’t answer me.”

“I… I assumed not. You asked more than once.”

“It was a person.”

“…It seems so.”

“They were people.”

“…Yes.”

“I killed it.”

“I killed a person.”

“No, no, Link- no-“

“Yes. I did.”

The person was already dead, master.

“Shut up, Fi.”

…

“…Link…”

Link. You’re an asshole. “…Sorry, Fi.”

…

S$#%.

“Link, had you not stabbed it, it would have attacked me just as it had you.”

“Y-your wound needs tending, sir. Do you have that alcohol?”

Alcohol.

Alcohol. Right. Right- “In the pouch.” Here. Here it is.

Zelda. Unstopping it. Going to really, really hurt, its teeth just ripped my neck open. Lucky it didn’t hit my carotid. Hylian teeth. Not so sharp. It still… feels… like a mess, though… “AAaaAAAH! MMM! MMMGGGH. GGGH-HH. …GH-!”

“I- I shall bind it. A moment…”

The pouch- it lets her use it. Bandages.

She shouldn't. She is. I don't deserve.

“Link, I …shall remind you, my extraordinary knight, that you said you’d have felt no regret killing Vayden in my defense.”

“Th-that- was different.”

“How so?”

“He meant to kill you. His choice. This- this person- these people- they were innocent. Used.”

“…Perhaps. We know little for certain.”

“Seems clear.”

“It seems so, but let’s not jump to conclusions.”

“Fi refused to say it wasn’t a person.”

“…I know. I’m … sorry, Link.”

Bandage… done. I thought Daile- Daile?

Oh.

I’m not the only one who feels sick, either.

He just had the presence of mind to go deal with it quietly in a bush.

We didn’t even check the barn yet.

No wonder the horses wouldn't approach.

What the hell did this?

-----

[Note: I decided after lots of thinking that there's more than one way to make a ReDead. I also decided the purple stuff in the bottom of the Ancient Cistern is malice, and that evil crystals are solidified malice. I also know why this is happening here even though it didn't (at least explicitly) happen in pre-calamity BotW, but I'm not telling. Spoilers!]

Read Next: A blanket of shifting shadows.

Follow this link for the post list for this fic.

Follow this link for my fic masterlist.

#adventure log+#botw #zelda #zelink #loz #breath of the wild #legend of zelda #fanfic #adventure log+ au #comedy #action #horror #fi

31 notes · View notes

goldenworldsabound · 11 months

Note

🌙☕🔪???

Thanks Rattie! <3 OC Asks

Gonna do the botw trio - Wendy, Crystalline, and Vaati

🌙 If your OC could have one wish come true what would it be and why? Would there be consequences to this wish or would they regret it once they get what they want? What would they give in return for this wish to come true?

🔎Wendy - for a very long time it was for Vaati be accepted by Kakariko and the other Sheikah. By the time TOTK rolls around that dream is in progress - but it was something very important to them. Once he left the village to join the Yiga Clan, they decided if they were ever able to get him back (also a wish they had no way of fulfilling) they would stand up for him loudly the way they failed to as a child.

And that is exactly what they do (with Crystalline's help) when he comes back to them after botw.

🗡️Crystalline - no more pressure as part of "destiny" or "fate". No more pressure or expectations from others in general. This has gotten better post botw, though it does ramp up again somewhat with the Upheaval in totk. People reply on them and look to them and it's a lot. I think if this wish came true they would regret it ultimately - they do like helping people, they just need to find a healthier balance with boundaries (which Mipha is helping them with!). They also really wouldn't be willing to offer up something of equal value - their strength and skills for example. They don't really want to lose what they have, even though they think they do.

💜Vaati - he wishes he could have been like Wendy and Crystalline. Loved and cherished from the beginning, and given a role to fill. He does find that role in totk (I've decided he inherited gloom resistance from Rauru, since I have Vaati as a descendant of Aura and Rauru, which makes him an excellent candidate for exploring the Depths under Josha's guidance). By the time totk rolls around I think he's starting to accept himself. If this wish came true, his entire life would change, and he'd be someone different. I don't think he knows how to feel about that, really. Over time this wish diminishes as he finds his own place, with Wendy and Crystalline, but also with his own chosen family.

☕ Give us one (or more if you feel like it) of your OCs deep dark secrets! Why do they keep it hidden? Spill the tea!

🔎Wendy - They regret so much not standing up for Vaati even when they had the opportunity. It's a little piece of pain they carry around with them. They pretended not to hear and see and they are ashamed of that. This will end up coming out to Urbosa of course, but it's something that they feel means they are actually terrible. But they were just a kid too - and it doesn't change the person they've become. But it's too painful for them to talk about and they don't want to talk about it, generally.

🗡️Crystalline - besides Mipha, they completely avoid letting anyone see them break down, ever. So that's one thing but it's not really a deep dark secret. I mean, at their core, they don't want anyone to know they care because vulnerability is scary. But I think they've also done a lot of murders (oops jumping to the next question) for the sake of the Sheikah and fate and whatever, and I they don't want anyone they care about (esp Mipha) to see how cruel and bloody they can be when it's needed. They keep that part super hidden. Sure, folks probably suspect they kill since they crusade against the Yiga Clan and do what it takes to protect Kakariko, but...they don't understand the extent of the bloodbath.

💜Vaati - he's deeply deeply afraid that what the Kakariko elders said of him - that he's an ill omen, that's he's evil - is true. Even as he joined the Yiga Clan and sought power (ultimately going so far as to try and take it from Calamity Ganon which would not have worked), he was afraid of it being true. That he was innately bad. It's not true! But that deep rooted fear is something he never wants to share because it feels almost like validating what they said about him, if he's concerned about it, you know?

🔪 Has your OC ever killed someone? Ever had to defend themselves against violence? How did this make them feel? Or, alternatively, has your OC ever attacked someone? Seen someone die?

🔎Wendy - never had to kill. Defend, yes, though mostly they run away fkjhafkjdhsak and they've seen Urbosa kill Yiga Clan members. They've had some close calls with bandits on the road and those have shaken them pretty bad, but they still don't think they could ever kill someone. Seeing Urbosa do that was definitely scary too - but Urbosa takes life only when necessary and this is comforting to them.

I don't think they've even killed a monster before fjdsahfkjdsa though they do think they could maybe stomach that a bit better? Seeing Urbosa kill monsters doesn't bother them really.

🗡️Crystalline - so much murder. Monsters and Yiga Clan members. I think it's messed them up to some degree since they've done it from a young age. But it's a part of themself they try to sequester off and not show others, as I mentioned. The first kill was rough and they refused to confide in anyone - but by now, it's almost thoughtless, particularly as it pertains to the Yiga Clan. Kohga is SO lucky he never runs into them fdkjsahfkjs

💜Vaati - as a member of the Yiga Clan, he certainly has killed, both within the organization as part of his advancement (oopsies) and outside of it in the world. Plus monsters. He dealt with it just as poorly as Crystalline - except that even if he had wanted to confide in someone (which he did want to), there wasn't anyone to listen. Other Yiga Clan members would view it as a weakness, for sure. Once he left, he prefers not to kill if he can avoid it, though that rule doesn't extend to violent monsters.

#botw si #totk si #botw vaati #totk vaati #thanks!!! :D #I was having fun can you tell

3 notes · View notes

moefongo · 2 years

Note

Hello!! Can I ask for hcs for Ghirahim, Astor, Kohga and Sooga with an s/o who draws them often? Like maybe they find a sketchbook and its just full of drawings of them

Dkdkke yes this is awesome!

Ghirahim

Ghirahim is beyond flattered, he is hyped at the fact that he is their muse!

When he confronts them about it he just gushes on about how amazing their drawings are.

May or may not begin to start randomly posing in case they want to draw him at any given moment.

Astor

He found the sketch books on accident, he was looking for one of his books when he stumbled on a hefty stack of sketch books.

After some debating, he decided to take a peek on one of them, and it turned out to be filled with drawings of him. Particularly with drawing of him wearing cat ears.

Then he peeked at the others and to his surprise they had even more drawings of him.

He liked that they drew him so much so he pretended to not see the drawings in case they might be embarrassed and stop drawing him. Though eventually they find out because Astor ends up buying a set of cat ears to wear daily.

Kohga

He already knows they draw him and in fact has commissioned his S/O to make posters of him to serve as propaganda on how cool he is and how strong they Yiga clan is.

He does lay on a couch seductively insisting to be drawn like one of those 'french girls'.

May or may not make attempts to draw his S/O from time to time just to join in on the fun.

Sooga

He caught them as they were sketching him. They swore he was distracted with training, but in the blink of an eye, Sooga was standing behind them.

He asked them why him out of other better things they could draw. And they simply answered by telling Sooga that they draw what they love the most.

Sooga gets flustered by their response and awkwardly goes back to training so they can draw him some more. But in his mind, he had the intent of asking them to show him all of their art work, which he will definitely do later in the day when they are in the intimacy of their quarters.

#loz #hyrule warriors #legend of zelda #ghirahim #hw aoc astor #aoc astor #sooga #kohga

26 notes · View notes

vertebrates-and-pieces · 9 months

Text

I've been showing my dad some of totk and whenever I'm in the depths and he's there im mentally crossing my fingers that i wont run into Kohga because i just know im not going to be normal and start explaining how awesome it is tgat i get to join the yiga clan (even if for infiltration purposes) and how I wanted to be a silly banana ninja since botw and then I'm gonna end up explaining kohga's role in aoc and why he's the best Zelda villain and its going to just be this image as he just watches this ridiculous failman that I won't shut up about try to kill me

#emmie talks #yigaposting

1 note · View note

russieraholic · 1 year

Text

A New Epoch

Author’s Note: Here is where a little more of the TLoZ features stand out- some location names, as well as the main focal point of the story the Yiga Clan, are present. Regardless I still encourage you to give it a try.

Khiena and Itsuki are original by me and my partner. Just fyi. Also please let me know if I make any stupid typos again. Enjoy!

Part 1 | Part 2

———

Krux and his brother were discussing their next step in figuring out how to settle in this new land. Their slipshod cabin had held up well enough, but it was time for the two to pursue a more stable means of housing. Thankfully, the past few weeks, Acronix had been getting that set up for the two twins.

“So, where did they say they were going to meet us again?” Krux asked, looking at a map of the land he was holding.

“A fork in the road where Torin Wetlands splits into the East Plains. It should be right here.” Acronix pointed to a spot on the map north of them.

“Hm, a smidgen over twenty kilometers. If we time it right we should be there by evening, and we can set up camp nearby with the men.” Krux inferred.

“Yeah, but that’s the easy part. Getting to home base is what’s going to be a real test of endurance.”

“Why? How far is it from here?”

“A hundred-and-fifty kilometers. Which will take us about three days with breaks included.”

Krux looked stunned at the revelation, but sighed when he realized there was truly no other choice. “Very well… I hope that they provide transportation.”

“They did! They got us a big horse that we can share, and I know you enjoy riding. So feel free to take the reins.” Acronix assured him, and finished packing his bag, doubly making sure he had everything. It wasn’t much, but he dare not leave his plush, any of his armor, and although the twins had their powers back, their time blades (powerless as they were,) could prove useful for their clan mates.

Krux packed his own satchel with non-perishable foods, water, and blankets for warmth. He didn’t forget his armor or weapons either, but didn’t seem as paranoid about forgetting something as his brother did.

“Are we ready to head off?” Krux asked his brother.

“Uhh, yep! That should be everything! I have to admit, brother, I’m excited.” Acronix seemed giddy.

“Hm, I look forward to it as well. These fellows you’ve met seem pleasant enough. Not to mention that their beliefs line up with many of ours.”

“What are we waiting for, brother? Let’s go!”

Boldly and excitedly taking the lead, Acronix left the shoddy cabin and took down the path north, that overlooked the ocean. The smell of the sea spray’s pleasant aroma calmed Krux’s typical anxiety and replaced it with a calm confidence. The two were very lucky that there happened to be a group of rogues willing to give them shelter and a place in their clan, as otherwise they may have had to live in complete solitude. There were rumors of the royal family of the country harboring a rather disquieting regime, and neither twin wanted to stick around and find out what that was about.

All monarchies seemed the same in their cultural insensitivity and cruel ideology.

“Brother, do you think we should conceal our identities? Just in case… you know, I’m sure being associated with these people don’t sit well with the uh, ‘commonfolk’. I’d rather not take the chance.” Acronix turned back to look at Krux, still walking.

“Hmm, you make a good point. We certainly are not in a place to take any unnecessary risks.” Krux agreed, pulling his hood over his head and gaiter over his mouth and nose.

Acronix did the same, and the two soon joined the main road they needed to follow for the next few hours. They passed by a few travelers sporadically, few of which seemed to pay the twins any notice. The brothers passed the time by bouncing from topic to topic, Krux often lamenting about how he would want to pick up playing the violin again, and Acronix disgruntled at the fact his cell phone was out of power and had no way of being recharged.

Krux had not even know his brother kept his phone, so that was a fun nest of bees Acronix had just stuck his finger in.

After a heated debate about the societal ramifications of introducing a quite literally alien piece of technology into this realm, the twins arrived at the fork in the path marked on the map. It seemed they had arrived earlier than anticipated, so Acronix decided to have something to eat.

“You know, apparently a lot of these folks’ society is built around the local “Mighty Banana” species. I mean, yeah it’s funny but I also get it. These are delicious. And not to mention they’ve got this almost… anomalous property. It makes me feel stronger, if only for a little while. Try one.” Acronix tossed a fruit to his brother.

Krux shrugged, pulling his scarf down around his neck, and gave the fruit a try. It tasted pleasant, but he was surprised as anything to find out that his brother wasn’t making the other part up. Krux felt quite a bit stronger, if only for a minute.

“I see what you mean. I wonder if their love for the fruit stems from this odd property or simply the flavor.”

“Well I assume we’ll be getting answers sooner rather than later!”

Acronix motioned with his head to down the trail, where two men could be seen riding on large horses, each fit for two people. Krux watched his brother flag them down with a strange wave of his hand, to which the two men could be seen acknowledging by speeding up a bit.

The twins watched the two disguised men bring their mounts to a stop, and hop off. One was of an average build and decently tall, with long black hair that fell to the sides of his taupe-colored face. A scarf his his full beard, his hazel eyes glistening in the bright sun. The other was weighty yet buff, with light skin and thin scarlet eyes. His curly salt-and-pepper hair was tied in a short ponytail, a small goatee hidden by his own scarf.

“Nix! Good to see you again!” The tall, tan-skinned man friendlily bumped shoulders with the younger twin.

The bulky man went up to greet the older brother. “Heya, you must be Krux. Nice to meet ya.”

Krux set aside his residual social anxiety and shook the man’s hand. “Ah, of course. The pleasure is mine.”

“My name’s Itsuki, and that over there is Khiena, my fiancé. We met your bro a few weeks ago, and could tell ya both were in a real funk. And as soon as he told us a bit about yourselves, we knew ya both would be safer with us,” The man said, motioning the group to get off of the main path.

Once the four were away from the road and out of earshot of any passers by, Khiena continued from where Itsuki left off. “Yeah. I’m not gonna sugarcoat anything, the Royal Family are pulling some pretty nasty eugenics bullshit. By that notion alone you two would be at risk staying in the eye of the general public.”

“I see, so it is true. We cannot thank you enough for your help, but pardon my slight hesitation. Why exactly are you helping us? My brother and I are not so quick to be so trusting.” Krux raised an eyebrow.

“We’re a clan of rejects and get our power in numbers. We’re all in a rough place and helping each other out benefits us all. Not to mention that you two have elemental powers. We could use more of us.” Khiena made a small electrical bolt arc between his fingers in demonstration.

Both twins faced the man in shock.

“Which is why when we heard ya were masters of time, we had to offer ya a place with us! There are people out there who will covet your powers, and we can protect ya from ‘em.” Itsuki concurred.

“Let me guess. Another part of the Royal Family’s twisted regime.” Acronix huffed, crossing his arms.

“Mm-hmm. Nearly lost one of our strongest men about a year ago. Got him back, but, the damage is done. Poor ‘Yato. They tormented him for intel on us. He didn’t spill a drop of it, had his eye taken out for his insubordination. Made it out on his own. Since then we’ve doubled down on our buddy system.” Khiena explained, setting their belongings down in a small clearing within a cluster of trees.

“That’s… cheery…” Acronix shuddered.

“The horrors are real. And ain’t nothing that either of ya deserve to witness or experience firsthand. We’ve got the scars to prove that there are bad people out there, and ya got a fighting chance with us. Unless ya would rather reconsider and join those gentrifying kiss-ups?” Itsuki teased.

Krux quickly shook his head. “No way. I would rather shed blood over my pride than live oppressed. If I have to fight for my rights, so be it.”

“Same here. But I can’t imagine what your guys’ public image is like because of all of this… I can imagine it’s not the best.” Acronix commented.

“GAHAHAH! Not the BEST?! Oh my gosh, dude. Are you kidding?!” Khiena howled with laughter for a moment, before catching his breath.

“Tell ‘em, ‘Suki.”

“Ah man, let’s see… well, the basic ones that get tossed around are ‘thieves’, ‘rogues’, ‘assassins’, but I’ve heard some more creative ones. ‘Desert Devils’, ‘Tinkle Ticklers’, ‘Crimson Snot-Eaters’, and ‘Scum Slickers’. Honestly I like Desert Devils, kinda badass.” Itsuki recounted.

Acronix was lying on the floor, completely doubled over with laughter upon hearing the term “tinkle tickler”. Wheezing uncontrollably, even. Krux sighed, and let out a soft chuckle.

“I can only assume the origins of some of those names.” The older twin said.

“Yeah. Mostly comes from the clan being comprised almost entirely of gay guys from all walks of life, and as ya might guess, that’s pretty easy to make fun of if you’re a total scumbag.” The bulky man huffed.

“I imagine those are some of the… nicer ones. I have heard some rather abhorrent terms used to describe us queer folk.” Krux nodded, setting some kindle down in a stone circle made for a campfire.

“Ya can say that again. When they ain’t using real weapons against us, they’re using their words.” Itsuki agreed, rubbing his fingers together and creating a spark that started the fire.

“Ah- you are an elemental master as well?”

“Yeppers! Steel, so I can’t exactly whip fire outta nowhere, but my fingers can act as flint and steel. Works well enough for our situation I would think!”

“I concur. …So, tell me, if you do not mind- how does the inheritance of your elemental powers work? And just how many of you are in the clan?”

“Right now there’s six of us, but here’s to hoping that’ll be eight soon! And we’ve got a few hundred powerless guys. As for how we got our powers, well, through inheritance. Mine were given to me at birth, Khiena had his gifted to him by an old mentor of his. The others are the same… well, except for the sensei.”

“Oh hey, yeah, we haven’t told Krux anything about the sensei. And heck maybe there’s some stuff I don’t know.” Acronix jumped in.

Khiena, who had just finished roasting some meat skewers for the group and was passing them out, decided to chime in. “Yeah. He’s a pretty great guy. Maybe I’m biased ‘cause he’s my adoptive father, but he treats the whole clan like a family. Though obviously being our sensei there’s a lot of horrible propaganda the Royals just love to spread.”

Itsuki sighed, rolling his eyes. “Yup. Though in all honestly, that propaganda has worked in our favor a few times. They paint him as this lazy, weak, and all-around dumb guy. So when there was a raid on our base by some soldiers, they only sent one battalion because the military leaders had been led to believe they wouldn’t need much firepower to take him out.”

Khiena chuckled at the memory. “Yup. Oh, they don’t know what hit them. It took him like what, thirty seconds to force them all into retreat? Our master isn’t a pushover and for sure isn’t stupid. But honestly, so long as the army keeps thinking that he is, they’ll keep losing.”

“Though that’s not been a problem for almost a year now. The clan and the Royal Family are kinda at a standstill at this point. A tense standstill, sure, but they say as long as we stay in the valley they’ll leave us be. But that’s starting to become a problem because our resources are drying up and we need to go get stuff. And that involves making our presence known again.” Itsuki added before taking a hefty bite out of his dinner.

“Yeah, pa says he’s been under a lot of pressure lately trying to decide what to do next. Which is another reason we can take all the help we can get. So… I hate for this to be so unofficial but, are you two in?” Khiena asked, turning to face the twins.

“You know I am.” Acronix nodded assuringly.

“Hm… well, all things considered, I think this is the best course of action. I look forward to the future.” Krux agreed.

“Awesome! Thanks so much for agreeing to help us out, and hopefully we can provide you guys with a decent means to live off of. And of course, the freedom to be yourselves and no less.” Khiena was pleased, and finally dug into his own dinner.

“So, here’s the plan. I think it’s gonna take us about three days to get to base. There are two overnight stops that ‘Keen and I planned out. Ya got a map?” Itsuki asked.

“Ah, yes, sure. Here you are.” The older twin handed the man his country map.

“Great. So here and here,” Itsuki marked two points on the map. “There are two hidden shelters that we can spend the night. One here by Crenel Hills, and the other at the Canyon Pass. That’ll divide our trip pretty cleanly into thirds.”

“Man, you weren’t kidding when you said it was literally halfway across the country from here. Holy shit.” Acronix looked stunned.

“Yeah, I know, it is a bit of a trek but hey, at least we have some ol’ geldings to do the legwork for us.” Itsuki said, looking over to the two resting horses.

“Ah, what are their names, by the way?” Krux asked.

“We dunno. They ain’t ours. Just a couple of rentals we got from the desert entrance stable. Our real mounts are in the desert itself- we couldn’t really bring ‘em even though we really wanted to. But it’s safer for them there cause anywhere outside of the desert, we’d stick out like a sore thumb.”

Khiena leaned against his fiancé. “Oh, that would’ve been so awesome. But yeah, ‘Suki is right, we don’t want to risk the lives of any of our animals. Not to mention that yeah, they’re a special kind of animal that only our clan owns, so of course that would raise a few eyebrows.“

“I remember you telling me a bit about that… my curiosity is reignited! The younger twin seemed enthusiastic.

“Save it for tomorrow, Nix. We gotta long journey ahead of us, we oughta get some rest…” The big man let out a big yawn, giving his fiancé a cuddle back.

“Good point… thanks for making dinner. Let’s get up at… eh, an hour or so after day breaks. It’ll be better to start when it’s still nice out.” Acronix suggested.

“Good call. See you then?” Khiena looked for mutual confirmation.

“Indeed. Let us start to rest now, in that case.” Krux nodded.

“Ya got it. Night y’all!”

#ninjago #krux and acronix #ninjago time twins #hands of time #yiga clan #queer rights

2 notes · View notes