#The nifty bidder

[thuganomxcs]

unprompted / always accepting / @adversitybloomed

❛  it’s okay, i’m fine. you don’t need to worry so much.  ❜

Noted, she was pretty tough. That was quite an attack she took..and yet she seemed to be in one piece, either way now these demonic reptile-like demons were extremely strong..definitely different breeds. Not only were they strong but they were also incredibly nimble and quick, so much that even Yusuke had sustained a few injuries. Bruises on his face and no telling how many scars were left upon his body over his clothes. 

“Least we know how people have been disappearing in town lately.” Said Yusuke explaining the one positive regarding the discovery of these scaly demons. Because of their nifty ability to camouflage to the point of near invisibility, there’s an explanation on how the people have been kidnapped, and with his body feeling numb due to the ‘venom’ dripping from their claws he also discovered just how they’ve kept them quiet even after abducting them during the day.

“I only hope we’re not too late.” The bravado in his voice had left, his tone was serious as he took another step forward. There have been some teenagers being abducted some..weeks ago versus the more recent disappearances. The demon caught on Yusuke’s sentence and simply cackled under its breath as its tongue swiftly exits its mouth to exhale a hiss.

“Hear that boys..it looks like we’ve got ourselves spirit detectivesssss.” Its voice was sinister with hisses leaving its maw. The others(7 of them) cackles before it turned into laughter. “If we catch them alive they’ll ssssell for a hefty pricccccce.” The demon says as the eight of them kept their claws poised for attack. 

“Somethin’ tells me even if ya do sell us off t’ the highest bidder…you’re not gonna get as much as you think.” Yusuke said. He was a FORMER spirit detective and as for Mulan..she was a mystery all on her own.

#❛ mail ━━ when i rush make your butt pucker the fuck up. #adversitybloomed #thought it was an old meme but i scrolled and scrolled so i figured it's unprompted

[peterkester96]

Nifty Gateway Clone- A Custom Made Solution For NFT Marketplace Development

The Nifty Gateway Clone script is an exact replica of the NFT marketplace stage for the Nifty gateway, with significantly altered features and functionalities. A blockchain-based NFT marketplace stage clone called Nifty Gateway enables clients who have signed up to trade NFTs. Providing blockchain-controlled NFT Marketplace Programming Development solutions for our significant clients, Hivelance is a leading NFT Marketplace Development firm. The Ethereum blockchain technology is used by our Nifty Gateway clone software, a true NFT trading platform, to create computerised works of art, recordings, realistic playing cards, and other things.

The Best Features Of Our Nifty Gateway Clone Script :

Virtual Exhibition: A visual feast featuring a sizable selection of handiwork that is for sale.

Index - Direct the more developed expressions of your foundation into numerous groups with clear distinctions.

Advanced Wallet - Enable your customers to instantly link their secured cryptographic money wallets to your Nifty Gateway clone platform in order to conduct seamless transactions.

Installment Gateway - High-end, beneficial features for installments, including credit and charge cards.

Closeout/fixed Deal: Creators of content have the option of selling their creations, and a set deal option is provided.

The benefits of our handy Nifty Gateway clone script

The Nifty Tasteful

Selective work of art

Simple To Utilize

Buy NFT with Visa

Application Development Income Models for the Nifty Gateway Clone :

Eminences - Every exchange requires a certain amount of consideration.

Gas expense - The blockchain-based approve exchange may impose a gas fee.

Posting fee - NFT creators and merchants must pay this fee each time they want to list their advanced collectibles.

Beginning arrangement expenditure - To advance their advanced total and advertise collectibles for sale

Packing expense - Enabling suppliers to deliver multiple items at once will benefit the NFT handicraft market's ubiquity and strong initial capital investment return.

Nifty Gateway Clone Script Development Cycle:

Step1 The craftsperson or dealer must register their name on the entryway stage. Step2 The dealer must access their advanced wallet and enrol their Gateway account before they can start NFT (purchase/sell) trading. Step3 The professionals or vendor might transfer advanced copies of their artistic creations to display them on stage. Step4 For the purpose of selling their NFT or setting a price, the artisan might specify the precise closeout type. Step5 The auditing process. Following the endorsement, buyers can see it listed on the NFT market. Step6 The winning bidder is given ownership of the task following the transaction. Therefore, the cryptocurrency is transferred to the dealer's wallet.

Why Would You choose Hivelance Town For A Cool Nifty Gateway Clone Development?

Hivelance provides superior Nifty Gateway NFT Marketplace Development administrations to our esteemed clients as a leading NFT Marketplace Development Company. Create and maintain an NFT marketplace business website with high-quality features and functionalities, flexible options, and useful Nifty Gateway clone programming.

On all our products and services, we offer exclusive Independence Day deals of up to 30% off. Offer Valid Till 16.08.2023. Contact us.

Talk to Experts for More Info 

Call/whatsapp – [phone]

Skype- live:.cid.8e890e9d0810f62c

Telegram – https://t.me/HiveLance

#Nifty Gateway clone script #Nifty Gateway clone software #white label Nifty Gateway clone software

[zebu-helan]

How The Price Structure Of The Share Market Works

The market's stock prices are influenced by the amount of demand and supply. A company's market capitalization influences some of its share price. This is the sum of the stock price and the number of outstanding shares. The most recent sale price is used to determine the current asking price on the market. Assume the last closing price of 100 shares of company XYZ was Rs 50, and you want to purchase them. The fair market value of the share is (50 x 100), or Rs. 5,000.

Another way to determine the fair price is to use the discounted cash flow method. According to the hypothesis, the fair price is equal to the total of all future dividend payments discounted to present value.

The stock market is an interconnected network of exchanges, brokerage firms, and intermediaries that connects companies and investors. IPOs (Initial Public Offerings) are the process by which companies are listed on the market before investors can purchase their shares. An initial public offering (IPO) can reveal a company's market capitalization, and investors can purchase shares on the stock market from separate lists of large-cap, middle-cap, and small-cap companies.

Stock exchanges use indexes as well. The NSE and BSE in India use two different indices: the Nifty and the Sensex. These indices are composed of the best large-cap firms based on market size and share popularity. Most investors use these indicators to forecast market direction.

When discussing how the stock market works, another important term to understand is the bid-ask spread. The "bid" price is the amount that buyers are willing to pay for an underlying, which is usually less than the seller's "ask" price. 

How to Make a Profit on the Indian Stock Exchange

Companies send SEBI a draught offer document containing company information. Following approval, the company conducts an initial public offering (IPO) on the primary market to sell shares to investors. The Company offers and distributes shares to some or all of the IPO bidders. The shares are then listed on the secondary market, also known as the stock market, where they can be purchased and sold. Brokers place orders on the market after receiving them from their clients. When a buyer and a seller are found, the transaction goes smoothly.

#online trading company #online trading platform #lowest brokerage #stock market #stock market basics #basics of share market #stock market beginner #stock split #stock trading

[kavinsps]

Guide and everything you need to know to create and sell your own NFT files

What is an NFT? The word NFT comes from English, and means Non-Fungible Goods . That is, a digital asset that is unique.

It is a simple computer file that contains an image, a video, music, a document … any digital item can be converted into an NFT.

How can a digital photo, for example, be unique if infinitely many identical copies can be made?

Read the news : NFTs have brought about a revolution in the art and collecting market, because now a digital drawing, a graphic, a meme, can be turned into a unique NFT by associating it with a blockchain, and acquire the same value as a drawing or painting. in physical.

Millions have been paid for NFT development company of famous memes , and even the inventor of the web pages has sold the original code as NFT, for more than 5 million dollars .

What is a chain of blocks or Blockchain? We have seen how an NFT is a computer file , which becomes unique by assigning it a key that is managed within the blockchain of a cryptocurrency.

The mining of each cryptocurrency or token is recorded here, as well as all transactions of those tokens, when they change hands.

blockchain The key feature of the blockchain is that for any transaction of your cryptocurrencies to take place, it must be approved by 51% of all computers on the blockchain.

This is what makes cryptocurrencies and NFT development services impossible to hack, because it would require hacking thousands of computers on the network all over the world at the same time.

In summary We have seen how cryptocurrencies are encrypted keys, which are managed in their chain of blocks or blockchain.

This chain of blocks has many different uses, apart from managing cryptocurrencies. For example, it also manages NFTs .

Cryptocurrency hardware wallet to cold store dozens of cryptocurrencies like Bitcoin, Ethereum, ERC20 and many more.

Choose your NFTs The first step is to choose the NFT that you are going to sell. An artistic work pays well, but there are people who have become millionaires selling curious things, like women with long necks:

This is the software that a 12-year-old girl used to convert her drawings to NFT and win 1.4 million euros OpenSea

It is very common to make thousands of variants by mixing different parts ( eyes, hair, mouths ), using an app, and then sell them in batches.

There are even people who have become rich selling their own selfies , captured over the years:

NFT Market There are many NFT markets.

But there are many others that the specialized website The Motley Fool recommendations :

Larva Labs / CryptoPunks NBA Top Shot Marketplace 1.rallible 2.SuperRare 3.Foundation 4.Nifty Gateway 5.mintable 6.Theta Drop

Choosing the NFT market is important, because each one uses a certain block chain, and a certain cryptocurrency.

What cryptocurrency do I need? Most NFT markets use the Ethereum blockchain, so they use the Ethreum cryptocurrency . For example, Rarible uses the crypto call Rarible.

They all accept Ethereum for example, but maybe not some others Most use digital wallets , NFT Development services which are nothing more than an account on a certain specialized service. They are usually free, but they take a commission when you pay from the wallet.

Some widely used wallets are Metamask , Coinbase Wallet , Wallet Connect or Formatic . Buy cryptocurrencies Now that you have a wallet, check out the fees for selling NFTs on your chosen marketplace, and buy the cryptocurrencies you need to start selling.

Read the fine print well, because depending on the market they have abundant and strange commissions, depending on how you sell, how you publish, etc.

Binance

Upload your NFTs to the NFT marketplace

The service will guide you step by step. You upload the files containing your creations , and they convert them into NFTs, and put them up for sale on the market:

NFT Market They work in a similar way to eBay: you can put them up for direct sale, or in auction mode , to the highest bidder.

If you sell something, that cryptocurrency payment will be credited to your wallet , after deducting the corresponding commission.

#NFT development company #NFT development services #NFT development solutions

[nftdawnio]

Victor Langlois, who goes by the stage name Fewocious, is a teen NFT artist who has once again set a new all-time high secondary sale for himself. The NFT masterpiece "The Sailor" sold on SuperRare for a huge 350 ETH, which is about $595k at the current market price. The NFT was bought by "capital6529" from "2YeahYeah," who had owned it before. "Bringing a Fewocious into the 6529 family has been a very long time coming," the winning bidder said about the latest purchase. Fewocious's journey as a successful artist has reached another important point with the well-deserved amount. A well-known and visible member of a growing group of queer crypto artists has once again shown how powerful his work can be. The NFT for "The Sailor" has a face that is half human and half cartoonish. The looping NFT, which is very unique to Fewocious style, has a lot of small details that are hard to see at first. He said, "I don't know what's going to happen, and I can't be sure. my friend, I'm moving forward and up, or at least I'm trying." He also wrote on Twitter, "My sophomore high school English teacher saw this and messaged me to say she's going to use this piece and my story to teach her students about resilience." With these artists, the NFT space has become colorful, different, and new. So it makes sense that the art itself has found a place of pride in the NFT community. Well, Fewocious breaking a record isn't that unusual. He has also been called the youngest artist that Christie's has ever shown. People love his art so much that on the day of the "Hello, I'm Victor" NFT auction, the buyers' traffic caused the Christie's website to crash from all the sales. Also, Fewocious sold almost $19 million worth of NFTs, which was the third-highest amount in the NFT market Nifty Gateway. This time, "The Sailor" NFT stole the show by becoming the most expensive second-hand sale on SuperRare, which says a lot about how amazing his NFT art is. https://nftdawn.io/fewocious-sets-new-all-time-high-in-secondary-nft-sales/?feed_id=1698&_unique_id=630217a3a5877

[ds4techofficial]

Vignesh Sundaresan | The nifty bidder

Vignesh Sundaresan | The nifty bidder

On March 11, after selling an artwork for over $69 million to someone with the pseudonym Metakovan, auction house Christie’s noted that “this piece now ranks third amongst the most valuable artworks ever sold by a living artist”. No. 1 on that list is a stainless steel sculpture called ‘Rabbit’, the work of American artist Jeff Koons, which was sold for $91 million in 2019. And No. 2 is a 1972…

View On WordPress

#Everydays: the First 5000 Days #Metakovan #Mike Winkelmann #the hindu profiles #The nifty bidder

[liam-93-productions]

Liam Payne will next week auction a non-fungible token collection, becoming the latest artist to jump on the craze of selling digital art.

The One Direction star said on Wednesday he would launch his “Lonely Bug Collection”, which he created during the coronavirus lockdown.

“I’m so excited to drop this collection. It’s been a real labour of love for me over the past few months,” he said.

The artwork, which Payne says is aiming to reflect the childlike state that many people returned to during the pandemic, is multimedia with music from DJ Zedd, animation from Sillygabe and spoken word from Gary Vee.

NFT Craze

Payne joins hundreds of artists and celebrities in jumping on the craze this year for non-fungible tokens (NFTs), which are a kind of digital asset that exist on the blockchain.

The blockchain serves as a public ledger, allowing anyone to verify the asset’s authenticity and ownership. That is what investors and fans will be buying next week at a 24-hour auction through the popular Nifty Gateway platform.

Some of the best known NFTs this year have been Grimes selling $6m worth of art in March, Beeple selling a video at Christie’s for $69m and an animated meme called Nylan Cat selling for $580,000. The phenomenon has also spawned a whole generation of NFT startups.

In recent weeks the NFT frenzy has abated slightly, with the dollar value of sales falling from a peak of roughly $322m in April to $88m, partly as a result of a drop in the overall crypto markets.

Blending digital and physical

The Lonely Bug Collection is hoping to generate excitement though at least in part because it combines a series of digital artworks with the physical as well.

Part of the audition is the real-world experience of a dinner at a new 3,500-room Resorts World Las Vegas with crypto celebrities such as Paris Hilton, Mike Novogratz, Brendan Blumer, 3LAU , Steven Bartlett, Christian Angermayer as well as Duncan and Griffin Cockfoster.

Payne on Wednesday said: “I can’t wait for this to go live and to see the reaction from my fans, and then to be heading to Vegas later this year to meet with the highest bidders at what promises to be a once-in-a-lifetime event.”

Opening Up

The announced sale of the Lonely Bug Collection comes just days after Payne opened up in a podcast with Steven Bartlett about hitting “rock bottom” during his time at One Direction due to drugs and alcohol.

“I was worried how far my rock bottom was going to be. Where’s rock bottom for me? And you would never have seen it. I’m very good at hiding it,” Payne said on the Diary of a CEO podcast. “No one would ever have seen it.”

#liam payne #press mention #liam's nft #sifted #09.06.2021

[liamnews]

Liam Payne will next week auction a non-fungible token collection, becoming the latest artist to jump on the craze of selling digital art.

The One Direction star said on Wednesday he would launch his “Lonely Bug Collection”, which he created during the coronavirus lockdown.

“I’m so excited to drop this collection. It’s been a real labour of love for me over the past few months,” he said.

The artwork, which Payne says is aiming to reflect the childlike state that many people returned to during the pandemic, is multimedia with music from DJ Zedd, animation from Sillygabe and spoken word from Gary Vee.

Payne joins hundreds of artists and celebrities in jumping on the craze this year for non-fungible tokens (NFTs), which are a kind of digital asset that exist on the blockchain.

The blockchain serves as a public ledger, allowing anyone to verify the asset’s authenticity and ownership. That is what investors and fans will be buying next week at a 24-hour auction through the popular Nifty Gateway platform.

The Lonely Bug Collection is hoping to generate excitement though at least in part because it combines a series of digital artworks with the physical as well.

Part of the audition is the real-world experience of a dinner at a new 3,500-room Resorts World Las Vegas with crypto celebrities such as Paris Hilton, Mike Novogratz, Brendan Blumer, 3LAU , Steven Bartlett, Christian Angermayer as well as Duncan and Griffin Cockfoster.

Payne on Wednesday said: “I can’t wait for this to go live and to see the reaction from my fans, and then to be heading to Vegas later this year to meet with the highest bidders at what promises to be a once-in-a-lifetime event.”

The announced sale of the Lonely Bug Collection comes just days after Payne opened up in a podcast with Steven Bartlett about hitting “rock bottom” during his time at One Direction due to drugs and alcohol.

“I was worried how far my rock bottom was going to be. Where’s rock bottom for me? And you would never have seen it. I’m very good at hiding it,” Payne said on the Diary of a CEO podcast. “No one would ever have seen it.”

#liam payne #lonely bug #drugs tw #alcohol tw #09.06.21

[calvin-af-crone]

Forgive me if I’m asking a dumb question, but Is anyone even bidding on these things? I saw your post, but can’t tell if it has any bidders and I’m trying to catch up on tumblr in between my patients. I swear I am not an idiot, but no matter how much I read about this, I just don’t 100% understand any of it...

Yeah, they use “minted” instead of simply saying sold. Nifty Gateway collected almost half a million dollars in 10 minutes for TF 1 & 2. The bidding continues on the other 3 mv’s. From what I gather, it takes 24-36 hours for the new “owners” to be given access & then we’ll see if they start sharing or will sell their NTF’s for profit to someone else. 

We’re both having a hard time comprehending this concept because it’s ridiculous. Music videos aren’t baseball cards or framed artworks. They are audiovisual experiences. If you keep them locked up in a blockchain, they have no actual value at all. 

[nftlabs]

How to Become a Crypto Artist?

Art is universal. It speaks to everyone but recognizes no authorities. It adapts to the times and these days it’s going digital. If you publish your work on the internet, not only will it stay there forever, but you will also get the chance to reach millions of people. Against the background of emerging and flourishing blockchain technology, crypto art has become a trending topic.

Blockchain and Art

Blockchain has revolutionized the way we perceive money, ushering in an era of digital ownership. Bitcoin, as storage of value and digital representation of money, was the first successful use case for blockchain, and some creative developers thought they could expand the concept of bitcoin into something new.

The introduction of smart contracts has brought the blockchain to many new applications, one of which is non-fungible tokens (NFTs). Non-fungible tokens are unique, and NFTs are digital assets with unique and non-interchangeable properties that are standardized, universal, liquid, and programmable. NFTs are applied into collectibles, in-game items, digital art, certificates, domain names, etc.

Digital artworks are transformed into crypto artworks by NFT, and the original model of copying artworks to USB disks and CDs is turned to transactions on the blockchain. The transaction process becomes open and transparent, and technological innovations such as AI are also adopted in digital art creation. It is only a matter of time before the art world is mesmerized by NFT and numerous artists tokenize and monetize their works one after another in a unique way.

What is crypto art?

Crypto art is rare digital art. More concretely, it is limited-edition collectible art that is cryptographically registered on the blockchain via tokens, which means the origin and provenance of digital artwork is transparent and auditable; and blockchain technology enables the tokens to be securely traded from one collector to another.

Once a token is created, the artwork begins its journey on a specific blockchain, where fans or collectors can purchase the artwork with cryptocurrency and it can be exchanged, traded or held by collectors just like any other rare artwork. Typically, crypto artwork can be sold through an auction: the creator lists the artwork they want to sell, after which bidders place their bids and the creator chooses to accept or not accept the bid. If the bid satisfies both two parties, then a transaction is made. Once the digital art asset is sold, the nun-fungible tokens are transferred directly to the buyer’s wallet, and the corresponding cryptocurrency is transferred to the seller’s wallet. Thanks to the blockchain, each transaction takes place on a peer-to-peer network and is protected by cryptography. This means that neither the capital nor the assets are held by the gallery or any other third party.

What does NFT mean for artists?

The decentralized and transparent nature of the blockchain is automatically expressed in the tokens stored on the platform, and these properties are shown in art in the following ways.

First, ownership is digitized into tradable tokens, thus increasing the liquidity of the artwork. Artists mint their works and issue them on the blockchain, and if they want to sell a piece, they can set a price based on its value and leave the rest to the market to work.

Second, NFT can also be used as a reliable method of verification and authentication. Thanks to its traceability, it becomes easier to track down the authentication and previous owners of an item and a certificate of authenticity is no longer needed. Everything is done on the chain and the integrity and value of the work is maintained.

Finally, it lowers the barrier of entry for independent artists who can use this medium to list and sell their artwork without having to pay for expensive gallery services. It also helps artists retain full ownership of their work, avoid paying fees to third-party intermediaries or agents, and enable artists get a better return on their artwork transactions.

How can I tokenize my artwork?

Several projects have emerged in the crypto artwork space, and these platforms spare artists all the technical work, as the artists simply need to provide the crypto artwork. Some of the most popular crypto art collecting and trading platforms are described below.

NFT Showroom is an art tokenization platform built on the HIVE blockchain. NFT Showroom allows artists to log in with their HIVE account and tokenize artwork with the help of its sidechain and smart contracts. The biggest benefit of the HIVE blockchain is that it requires no transaction fees, so there is no cost when an artist submits a piece of artwork to the chain and puts it up for sale. Those who purchase through HIVE will need a HIVE account. Users of HIVE accounts need to stake a small amount of HIVE coins to pay for transactions on the chain, and these HIVE coins remain in the possession of the users and can be sold at any time.

Rarible is built on the Ethereum blockchain and allows anyone with an Ethereum wallet to create accounts to tokenize their art. Since Rarible runs on Ethereum, users need to top up their accounts with Ether to pay for on-chain transactions. What’s interesting about Rarible is that it allows users to buy art with ETH, and hundreds of ERC-20-based tokens. Compared to the NFT Showroom on the HIVE chain, users of Rarible can open up the artwork to more buyers for better liquidity and a larger user base.

Makersplace also uses Ethereum to manage the tokenization of artwork, but also accepts other cryptocurrencies and fiats. Makersplace only charges 15% of the transaction when a crypto artist sells a work, and an additional 2.9% if the purchase is made via credit card. In addition, artists earn a 10% royalty whenever their work is re-sold.

Nifty Gateway, owned by cryptocurrency exchange Gemini, allows users to create tokenized versions of artwork using the NFT token standard Nifties. This platform is created in 2018 based on the Ethereum blockchain. Crypto artist Beeple’s artwork “THE COMPLETE MF COLLECTION” sold at auction on Nifty Gateway for $777,777, making it the most expensive crypto artwork to date.

The difference

As Jason Bailey stated in his introduction to the first Italian crypto art exhibition (Tolmezzo, from December, 2018 to February, 2019), “Unlike the traditional art world, crypto artists do not have to ask permission from gallery owners, agents, auction houses, or other intermediaries to share and sell their work. Instead, they use the blockchain to make their own decisions about displaying their work and making it available. Naturally, traditional artists often talk nonchalantly about crypto art, but that is certainly an important sign that crypto artists are on the right path.”

#nft #blockchain

[catdemontraphouse]

@thotleviathan​ my darling frien suggested this Alastor from Hazbin is a furby fan moodboard!

naturally this made my brain go into FURBY mode

Headcanons for Alastor FURBY COLLECTOR:

He goes apeshit when he’s got his eye on a furby auction and someone tries to outbid him. The competing bidder is often never seen again, having disappeared under unknown circumstances. (spooookyyyyy)

He has a special room dedicated to his collection. It’s full of custom furbies who all have detailed backstories and elaborate names like “Mr. Beakbeak McAlastor the 6th”

He’s got a furby organ but that’s just canon sooooo

He actually, genuinely laughs at the 05 furby’s horrific jokes.

He is slowly trying to convert the rest of the hotel occupants into the furby fandom and Angel Dust is extremely unhappy about it

Has a massively long long furby that he’ll leave in a room purposely and then pretend to come across out of the blue like “Myyyyy what are you doing there, little fellah?!” It annoys the crap out of everyone but Charlie, who was the only one convinced to get a furby besides Nifty 

ADD UR OWN HEADCANONS IF U WANT OK? I LOVE FUBY UWU

#hazbin niffty #hazbin alastor #hazbin angel dust #hazbin hotel #furby fandom #furby #moodboard #cursed moodboard #wtf #lol #oddbody furby #custom furby #long furby

[son-of-alderaan]

IT'S JUST BUSINESS:

Even before DJ taught Finn and Rose about the Sisyphean galactic weapons industry in The Last Jedi, established companies were already vying for military contracts from the highest bidder. Once the Clone Wars were over — the Jedi gone and the Empire in control — Raith Sienar's Sienar Fleet Systems went from manufacturing military shuttles and landing crafts for the Republic Navy to manufacturing the same things for the Imperial Navy and Army.

In an effort to quell resistance throughout the galaxy. Grand Moff Tarkin "commissioned Sienar to create "a line of single-pilot, short range starfighters for the Navy." In addition, he asked that they be fast, efficient, and easy to build. This request led, of course, to the TIE Fighter.

THE EMPIRE CUTS DOWN ITS CARBON FOOTPRINT:

Another one of Tarkin's requirements for the TIE Fighter was that it be "energy efficient" and greatly "maneuverable." To help achieve both ends, Sienar did not originally design this starfighter with a hyperdrive or deflector shields. This is why TIEs are so easy to destroy by Rebel and Resistance X-Wings. Moreover, Emperor Palpatine approved these glaring Achilles' heels, as he felt that if a pilot knew they were flying an unshielded vessel, they would be all the more driven to accomplish their "mission goals."

THE STORY BEHIND THE SCREAM:

Why do TIE Fighters make that unique "screaming" sound during aerial dogfights? We now have a definite answer: Emperor Palpatine wanted them to intimidate the Empire's enemies by letting out "a noise akin to a screech from a bird of prey." This specification was laid out to Raith Sienar in a memo from Tarkin who added, "The noise will make [our enemies] freeze behind the triggers and controls of their own weapons. The noise will be the last sound they hear before the starfighter opens fire."

KYLO USES HIS FAMILY GIFTS:

Kylo Ren (also known as Ben Solo) had the good fortune to be the son of Han Solo and the nephew of Luke Skywalker. Not only was Kylo strong with the Force, he also inherited his father and uncle's excellent piloting skills. After joining up with the First Order, Ren served as a test pilot for an all-new type of starfighter, the TIE silencer.

Looking to previous TIE iterations for inspiration, the silencer (aka the "TIE vendetta space superiority fighter" or simply the "TIE/vn") does have deflector shields and a hyperdrive. It also excels in the categories of "energy conversion, power storage, and experimental stealth gear." Kylo's feedback after the prototype test flight proved invaluable to the technicians at Raith's company, which had, after so many years, evolved into Sienar-Jaemus Fleet Systems.

FIGHTING AN X-WING:

You can see this in the page above, but the book does include some nifty tactics for TIE Fighter pilots squaring off against enemy X-Wings. The "Reverse Throttle Hop" is a favorite of the First Order; a move meant to slow a hostile pilot down in their tracks. When an enemy has been destroyed, however, TIE instructors emphasize the fatal mistake of a temporary victory bringing down one's guard. To quote a former Imperial pilot by the name of Han Solo, "Don't get cocky!"

A BLACK BOX FAR, FAR AWAY:

Like airplanes on our planet, every TIE Fighter comes equipped with a "flight data recorder," a black box-like device that "contains complete records of a craft's range, top speed, shield array, weapons, payload, performance parameters, and recent history." If a ship crashes or is destroyed, the recorder (located beneath the pilot's seat) can be recovered from some of the most extreme conditions and fill in the gaps of what went wrong and why.  

#tie fighter #sw books #kylo ren #the empire #the first order #long post

[awareblockchain]

State the features on how to launch your NFT marketplace like nifty gateway?

Launch Your NFT Marketplace Like Nifty Gateway requires a clear insight about the Nifty gateway platform and assistance from a renewed marketplace development company. With guidance from a group of people sharing their thoughts, you can launch your NFT marketplace like Nifty gateway.

However, there are some distinguishing features of Nifty Gateway to be considered before constructing a platform:

Features:

Virtual Gallery

This feature helps you to give your visitors a visual treat with a gallery of for-sale artwork. However, make it more useful by including information about the artwork, such as the author, owner, prior bid price, and so on.

Catalog 

Sort the innumerable digital creations on your site into categories like live auctions, NFT drops, most popular nifties, and so on. As a result, the user experience has been drastically improved.

Digital wallet

This feature allows your users to connect their crypto wallets to your Nifty Gateway, like the NFT marketplace, to make transactions go more smoothly.

Bundle Listing

Here, a single work of art or a collection of works might be listed by artists (NFT projects). Moreover, the number of NFTs that can be listed is unrestricted.

Auction/Fixed Sale

Here, content creators have the option of selling their works at an auction or for a minimum fee. However, the time and starting price for an auction is set by the owner, and the item will be sold to the bidder with the highest price at the end of the auction.

Payment Gateway

Make your users feel at ease by providing them with convenient payment options such as credit and debit cards. They can also use cryptocurrency to make payments.

Conclusion

Launch Your NFT Marketplace Like Nifty Gateway at the earliest with the help of marketplace development solutions from a top-tier company. You could beat the heat with the help of renowned solutions at an affordable price.

#launchnftmarketplacelikeniftygateway #nftcommunity

[cryptodailysun]

Crypto companies continue to ramp-up marketing efforts with sports stars, with Beckham the latest to partner with blockchain provider, DigitalBits. Iconic former English Premier League footballer, David Beckham, has become a global brand ambassador for the DigitalBits blockchain, launching his own range of NFTs in the process.Beckham will release a series of NFTs and “other Blockchain-based digital assets” according to the brand ambassador announcement, with minting taking place on the DigitalBits blockchain.Excited to announce #DavidBeckham has become a Global Ambassador for #DigitalBits! Get ready to explore the world of #Blockchain, #NFTs and #Metaverse with Beckham. More details https://t.co/yafO7W2OuL Thread pic.twitter.com/n54BMeDsnE— DigitalBits (XDB) (@DigitalBitsOrg) March 24, 2022 Beckham said the NFT collections were an “opportunity to create new experiences for my fans online.” According to DigitalBits, Beckham has a following of over 138 million, with an annual impression rate that surpasses nine billion across Instagram, Facebook, and China based social media platforms, Weibo and Douyin.Crypto companies, in particular crypto exchanges, are ramping up partnerships with sporting teams and icons in a marketing effort to target mainstream consumers.CoinSpot launches NFT marketplaceAustralian based crypto exchange CoinSpot announced the launch of its new in-app NFT marketplace, allowing users to purchase digital art using a selection of cryptocurrencies such as Bitcoin (BTC), Ethereum (ETH), Cardano (ADA), and others.CoinSpot said initially it will list only a selection of NFTs, including those from the Bored Ape Yacht Club, with more collections to be added over the next few months.Gary Howells, Chief Product Officer at CoinSpot said its marketplace was created to simplify the process of buying an NFT, and make the transaction more affordable with lower fees in comparison to using other marketplaces.Snoop and Wiz drop music for ApeCoin holdersAmerican rap artists Snoop Dogg and Wiz Khalifa have released a special project consisting of eight tracks sold as NFTs featuring a theme tune for the Bored Ape Yacht Club. Smoke a Bored 8th . Droppn a special project $APE COIN only @wizkhalifa @BoredApeYC ▶️ https://t.co/8JXyIRN3Pm pic.twitter.com/yh8DFrEdj1— Snoop Dogg (@SnoopDogg) March 24, 2022 The collection, titled “Ape Drops 03 : An 8th” can be minted through Manifold, with each track available for purchase exclusively using ApeCoin (APE) with prices ranging from 12 to 15 APE, ($155 to $195).Snoop Dogg and Wiz Khalifa both own Bored Ape NFTs, setting them as their profile pictures on Twitter. Snoop has been active in the crypto space and recently released 10,000 playable avatars and a “SnoopVerse” in partnership with the SandBox metaverse.Liverpool FC partner with Sotheby’sEnglish Premier League football team Liverpool FC, announced its debut NFT collection in partnership with New York based auction house Sotheby’s.They have arrived. Welcome to the world of LFC Heroes Club pic.twitter.com/T6H3uI9bQL— LFC Heroes Club ⚽ (@LFCHeroesClub) March 24, 2022 The collection features two series, each with 24 artwork NFTs, each one featuring a player on the team. The “Legendary” collection will be open for auction and sold to the highest bidder, and the “Hero” collection sold at a more accessible price of $75.Other Nifty News:The US Department of Justice has arrested founders Ethan Nguyen and Andre Llacuna on wire fraud and money laundering charges for allegedly carrying out an NFT rug pull with the Frosties NFT project. If found guilty on both charges, the pair face up to 40 years in prison.One of Vanuatu’s island is being built as the new capital for crypto, dubbed “Satoshi Island”, the project is selling plots of land and “citizenship” to the island as NFTs and say the entire economy will run on cryptocurrencies and blockchain technology. Go to Source

[coinwealth]

NFT drop causes glitch in The Matrix, FTX.US adds Ethereum NFTs, token Baby Sharks…

The Matrix’s NFT revelations

Soaring demand for the Warner Bros.’ Matrix NFT avatar drop on Nifty’s this week caused the website’s purchasing page to crash.

Earlier this month, the film studio announced it would be dropping 100,000 unique Matrix-inspired avatar NFTs for $50 each as part of a promotional campaign for the new Matrix Resurrections film set to hit cinemas in the U.S. on Dec. 22.

After more than 300,000 Matrix fans queued up for the drop on Nov. 30, Nifty’s was forced to start and stop the queue multiple times due to max capacity-induced “infrastructure issues.”

Hello again everyone. While we are obviously still working through the launch not going the way we had hoped it would, we appreciate every single one of you that have hung in with us, and we want to send a very sincere “thank you” from our team.

— Nifty’s (@Niftys) December 1, 2021

After the queue was paused multiple times, other issues started to occur such as users being bumped up or down the queue, the buy button not working and failed transactions upon checkout.

At the time of writing, there are still 347,133 people waiting in the queue and the issues are yet to be resolved. Nifty’s said that it is still actively working to address the issues, and has offered every Nifty’s user who queued up on Nov. 30 a free “glitch in the Matrix” NFT” for the inconvenience.

Warner Bros.’ The Matrix Avatar queue: Nifty’s

Tokenized Baby Sharks

Pinkfong, the creators of the widely popular and alarmingly hypnotic children’s song Baby Shark, is releasing a collection of NFTs depicting content from the music video.

The collection consists of a 1/1 and five limited editions, and the NFTs feature the Baby Shark character along with its five family members in a series of animated and holographic GIFs backed by new original music.

The auction and sales will be hosted on Makersplace on Dec. 3, and the carbon emissions from the sale will be calculated and offset by sustainability platform Aerial. A starting price for the 1/1 NFT auction has not been specified, however the highest bidder will also receive a custom one-of-one vinyl record of the music depicted in the NFT.

Pinkfong’s Baby Shark NFT: Makersplace

The Baby Shark music video has more than 9.7 billion plays on YouTube, making it the most played video on the platform.

MBA students raise $3K for scholarship fund

A group of Masters of Business Administration (MBA) students from the Paris branch of the INSEAD graduate business school raised $3,000 for the school’s Robin Hood Scholarship fund via an NFT sale.

Ferdinand Issels, Michelle Yu and two other students created a Nyan Cat-inspired NFT titled “RobinGood #1” depicting Robin Hood riding a salamander from the school’s emblem. The project was a part of a week-long student-led fundraising campaign for the school’s fund that supports need-based scholarships.

 INSEAD’s Robin Good NFT: OpenSea

The NFT was auctioned off in fiat currency to allow any student to participate and was snapped up by graduate and Goldman Sachs banker Alberto Marega for 2,600 Euros, or roughly $3,000, and has since been minted on OpenSea.

“It is an amazing feeling that we were able to use this technology to contribute to a good cause,” said Issels, adding that, “I hope this encourages other people to further explore the positive impacts that blockchain-based technology can deliver.”

Related: ‘Crypto Critic’ — Hollywood insider has a message for celebrities who shill token projects

FTX expands support to Ethereum NFTs

FTX.US revealed today that its NFT marketplace has expanded support to Ethereum-based NFTs.

gm! Ethereum NFTs are live on https://t.co/IER7ate2sU!

We’re excited to expand our NFT marketplace, allowing users to buy, sell, and display their Ethereum NFTs alongside their Solana NFTs for the first time! Probably nothing. pic.twitter.com/DREqxvNDVc

— FTX – Built By Traders, For Traders (@FTX_Official) December 1, 2021

Both FTX and the company’s U.S. subsidiary first jumped into the sector in September, rolling out NFT marketplaces with limited functionality. The following month, FTX.US expanded upon its platform by offering support to Solana-based NFTs.

FTX.US’s website now hosts a list of collectibles from popular Ethereum-based projects such as Bored Ape Yacht Club, Meebits and Pudgy Penguins.

Ethereum NFT collections: FTX.US

Other Nifty News

Upcoming mobile-based NFT game Guild of Guardians generated $5.3 million from the sale of two tranches of its native token GEMS on Tuesday. The sellout token sale was oversubscribed by 82 times with around 808,000 users registering and more than 10,700 new GEMS hodlers purchasing a max amount of $500 worth of tokens.

Ross Ulbricht the founder of now-defunct dark web marketplace Silk Road, caused a stir on Wednesday by announcing his own NFT drop depicting hand-drawn artwork that will be auctioned off on Superare this month. Proceeds from the auction will help fund a trust to support Ulbricht’s efforts to be freed from prison.

//platform.twitter.com/widgets.js

source https://usapangbitcoin.org/nft-drop-causes-glitch-in-the-matrix-ftx-us-adds-ethereum-nfts-token-baby-sharks/

source https://usapangbitcoin.wordpress.com/2021/12/02/nft-drop-causes-glitch-in-the-matrix-ftx-us-adds-ethereum-nfts-token-baby-sharks/

[spicy-dunkaroo]

Taking Power Back (One-Shot)

♫Now Playing: “Taking Power Back” by Spicy Dunkaroo…♪

❀ Word Count: 5k

❀ Rating: Mature, 18+, Minors Do Not Interact (please)

❀ Genre: One Shot (Not sure how to explain this haha)

❀ Summary: (Writing Prompt) Mora’s job was to take away the powers of supervillains as they’re admitted to jail. For a few years, she’d been reselling these powers to interested bidders on the side - no questions asked. Today, a prisoner showed up with a power so unusual, she decided to take it for herself.

❀ Warning(s): Please read!! Dark Content ☠, Mentions of Murder, Attempted Murder, Implied Childhood Abuse, Implied Bullying, Swearing, etc.

❀ Author's Note: Hello everyone!! This will be my first story/one-shot of hopefully many other more positive ones lol. Credit for the prompt goes to u/totoropengyou on reddit for the writing prompt!! Just want to warn you all once more if you skipped over the warnings, this is a dystopian world that's fucked up. Please read with caution.

☟❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀❀☟

Everyday seems the same as the one before it. Same coworkers at the same job, not to mention the same shitty work Mora has to do to get paid.

Her job is to extract the powers of crooked criminals that somehow ended up in the nation's most secure penitentiary. Why? Well, if it weren’t for her, most of these monsters would have probably destroyed the government and Gods know what else.

Somedays, Mora finds it easier to sleep at night when she doesn’t think of the ‘what-if’s’ of not taking on the government position, if she screwed up, and what if she was any less moral than she already was.

That’s not to say that she was any sort of ‘holier than thou’ being that had mankind's well-being as top priority. The job doesn’t pay her enough to be so kind to the shitty world she’s lived in for the last 19 years. There probably isn’t enough money in the world for Mora to change her ways now, now when the temptation has become that much sweeter.

Sure, maybe she could be helping the world out by not selling the quirks to the highest bidder every Friday night. But in all honesty, who gives a damn? Yes, the government would and probably would punish her to the highest degree, and most citizens wouldn’t be too pleased. Why be mad at her though? It’s the buyer's fault for throwing hundreds of millions of dollars for just one of the many powers she extracts from those crooks everyday. Most of them aren’t too bad, they at least seem nice with the weekly gift baskets and extravagant gifts they throw her way in hopes of getting a nifty power before it’s on the floor the following Friday night.

Then again, you’d never expect those who were begging to be in Mora’s favor to be in the positions they are.

If it’s any consolation, most of those bidders can’t even infuse the power within their own bodies without risky surgery and the high chance of dying.

See, nearly 70% of all humans born in this ‘age of power’ are gifted with one of the four types of abilities. There’s fight, flight, freeze, and then there’s the unknown fourth type, probably the most rare of them all, mutants. As they are listed, 43% of these humans have the fight type, 32% have the flight, 20% have freeze, and less than 5% have the mutation type. Despite this, research says that you have a good chance of walking past a human with the mutation type of power at least once in your life without knowing it. Since there have always seemed to be so few ‘mutants’ as they call them, there's not much information on the different variations of the ability outside of that they don’t fit in the category of the other three.

Lucky for Mora, she happens to be one of the very few with the mutation power. Her’s happened to be perfect for her government assignment as well as for her side business.

The government took it upon themselves to name this “company” Vera. Mora wasn’t too sure why this was outside of the Latin meaning of the word (truth), like some sort of ‘holier than thou’ complex she presumed.

Though there have been struggles with her ability. Since there has been little research done, nobody knew how to teach her to hone her skill. Not her teachers, advisor, biological parents, or her other parents in the past. Despite this, Mora feels that she has a pretty good idea how her power works now.

Did she ever dream about extracting a part of most humans' identity as her ‘ideal job’? Of course not, when she was growing up she dreamed about being a rockstar, firefighter, or a damn teacher, anything but the hell she’s had to live through day in and day out.

Since she was assigned her power type, she moved from one home to another, left one school after the next, and was always called a mutant. Although she wasn’t sure exactly when the government began to really lock their sights on her, she was heavily reminded of the fucked up world she lived in once she graduated high school. There were only ever two options for her. Look out for everyone else, or look out for herself.

When you’re asked if you’d be willing to become a human lab rat or work as an official government officer, just about anybody wouldn’t have thought twice about that choice. Though there are a few poor motherfuckers that wanted what was best for humanity. To that Mora thanks them for giving her the ability to have a choice. Besides that, screw humanity. The criminals on the street aren’t the monsters you’re told live in the darkness, the ones in your closet, or the ones hiding under your bed. No, sometimes those monsters are a lot closer to you, and they’re not there to protect you.

It’s a real dog-eat-dog world on both sides of the door. So look out for yourself, that’s the only way you can survive. Despite learning this throughout her whole life, Mora lived by the only saying she could remember from her time with her father.

‘Don’t let anything in this world tear you down. It’ll be tough, sure, but you deserve to pursue your happiness as much as anyone else because you’re a fighter- a winner! Never let anyone make you feel like anything less than the champion you are.’

Though she never understood what her father meant when she first heard it, now it’s one of the only few thoughts that seem to brighten her day as she looks back on her more fond memories of growing up.

Even now, as Mora sits in the holding room, it appears to be the only thought that can take her out of the mindfuck that was currently her train of thought as she regretfully remembered her last patient.

If Mora had the freedom her fellow peers had back in high school, she always thought she might have wanted to go to college to become a doctor. These happier possibilities help Mora to separate herself from her gruesome work. So regarding these scum of the earth beings as ‘patients’ helps to block off the blood-curdling screams that echoed in the walls many hours after they were moved to their prison cells.

As Mora begins to think of her perfect life, a knock is heard at the door, quickly followed by the door swiftly

“You okay in there Spe?”

“Oh, it’s just you Timentes. You scared me for a second there, also, please stop with the formalities. You know how much I hate my birth-given name. At least call me Griseo if you have to.”

“You know the rules, officially I can’t call you by your revised name, at least in front of others that is.”

“Then could you at least call me Mora in private?”

As she says this, Mora pats a spot before her at the small table, deciding to sit herself in the patients chair as she sees what they always saw before she conducted her ‘surgeries’ on them.

“Fine, fine, but only because you’re the most tolerable person in this hell hole.”

“Damn right I am! Ain’t nobody gonna take that title away from me haHA!”

“You worry me sometimes, Moralis.”

“Aww, is that your secret way of telling me you’re thinking about me? I’m touched, really, but I don’t think I can say the same about you, no offense.”

Timentes dramatically gasps as he places his right hand onto his bullet-proof gear, leaning back as he begins to speak once more.

“Offense completely taken. And here I was about to ask you out.”

“And by ‘ask me out’ you really mean make some instant ramen as we binge watch another anime this weekend? Because you know I can’t say no to that.”

“Which is why I always ask. You know you love our marathon nights! We- we might as well be a married couple with how often you stay the night.”

As Timentes says this, Mora notices the sudden change in demeanor, his cheeks becoming a brighter shade of pink of his stubbly face, the way his blue eyes dart away from her direction, and how she can clearly see how awkwardly cute his eyebrow quirks at his own words.

“I don’t think we fight enough to move that fast.”

‘If he won’t get the balls to actually ask me out, clearly we aren’t meant to be.’

Despite thinking this, Mora knew the real reason she was writing off her adorably shy co-worker. Mora knew she had to keep everyone at arm's length, regardless of her happiness in order to make it out of this world alive.

Mora rolls her eyes as she decides to change the topic.

“So...What did you come in here for? I know I’m a nice piece of eye candy, but you can’t let my womanly charms distract you from work. There’s only so many times I can cover for your ass.”

“R-Right...The next inmate will be coming in soon.”

“Okay? What’s wrong with him? Is he deranged? Violent? Or did he murder his family? Usually you don’t come to tell me about them in person either way.”

“The thing is… From what I’ve heard through the grapevine, this guy is something else.”

“Could you elaborate?”

“Well that’s the thing, I think it’s something about his power that nobody can figure out. We had to pull out all the stops just to restrain him. Who knows if he’s deranged or violent, apparently he took out 8 officers before he was apprehended.”

“Well, how’d they end up arresting this guy?”

“That’s the weirdest part, they didn’t.”

“They didn’t?”

“Well- they did but only after he surrendered.”

“You mean to tell me that this guy had more than enough man-power to escape, and yet after he was done screwing around he just- gave himself up?”

“Exactly.”

“So you’re telling me to be on high alert because you guys don’t know this guy's deal?”

“Yep. Everybody here knows how strong you are. But- you know the guys and I care about you, don’t you?”

“Yea yea, more like you’re worried this guy might catch my eye.”

“I’m being serious Mora… He's code 10.”

Despite feeling her nerves begin to creep up, Mora attempts to keep her composure as she blows Timentes off.

“I’m sure he’s not-”

Before she can finish her sentence, she hears a sudden thud, making her jump in her seat as she looks back over at the man before her.

“You and I both know there are no other inmates that are code 10. Hell, there hasn’t been a code 10 in years!”

Mora crosses her arms in disgust as she turns her head away without an answer.

“Oh Gods- Mora, I’m so sorry I just- I’m just worried about you-”

“Leave.”

“W-What? Lo-look I know I screwed up but-”

“I said leave. Go before you piss me off.”

Without another word between the two, Timentes stands up, hearing the metal chair scrape against the dull concrete floor, quietly turning to open the door behind him, the metal eye-sore loudly scratches against the frame and floor as it screeches open, and soon after slams back into its frame.

Mora can feel the tears begin to trickle down her cheeks as she refuses to look forward again. The memories of her past begin to flood in slideshow form as she feels a panic attack start up.

‘Damnit- Keep it together Griseo!’

As she thinks this, she wipes away the few tears that escaped her lids.

In the little time Mora had in isolation, juxtaposed to every other day, she’s able to calm herself down as she regains her composure once more.

Before she has a moment to breathe, the signaling of five knocks at the door are heard through the metal barrier as she is quick to stand up and move back over to her chair. She coughs in an attempt to drown out the dejected tone in her throat that was previously gripping at her vocal chords.

“C-Come in.”

Hearing this, three men step into the muted turquoise walls of Mora’s ‘office space’.

Two are wearing the familiar dark uniform, while one appears to be restrained in a black straight jacket.

Outside of the workers uniforms, most of their gear and restraints are color coordinated based on the risk factor code. Usually Mora only ever saw the white, orange, even the occasional red, but the most heavy duty of all was always.

‘Black? Timentes really wasn’t kidding when he said this guy was code 10.’

Mora begins to feel on edge as she stares at the man who appeared…average. The man stood at 6ft as he was seated in his chair, umber bangs seemed to be askew but still were able to hide his eyes completely. Minus a blistering red scar on his neck, the man before Mora looked like any other law abiding citizen. Although, based on the look of it, the scar appeared to be fresh.

As the two officers restrained the man further into his chair, Mora props her foot on the top of the table between them, waiting for the sound of locks to cease in its continuous echo.

Once the officers were finished, Mora waved them away dismissively, speaking up once she heard one of the two grip at the handle.

“Stand by and guard the door for me? I’m sure this won’t take long.”

As Mora looks back, the men both nod as they exit the suffocating room, leaving her with her newest patient.

Grabbing the clipboard that was left by one of the officers, Mora glances over at her patients health information, zeroing in toward the bottom of the page that listed his allergies, blood type, and ability type.

“Allergic to: None. Blood Type: AB-, let’s hope you don’t lose too much blood then.”

As Mora reads the final section, she notices there are many unprofessional scribbles with many question marks behind the possibility of what this man’s ability type was.

“So tell me, since you have nothing better to do, what is your power categorized as?”

Mora looks back up toward her patient as she waits for a response. After a moment if awkward silence fills the room, she speaks up once more.

“Here, I’ll tell you mine if you tell me yours, okay?”

Without a verbal or physical sign of agreement, Mora quickly gives in, but not before she has a bit of fun with him.

“I’ll give you a hint, it’s the reason why I have no chance at another job. Why I’ll be stuck under these assholes' thumbs till the day I die. Why I always hate it when my patients don’t cooperate. It just makes my job so much harder. Think that gives you an idea?”

There’s another moment of silence as Mora flimsily flips through the other pages of paperwork she’ll have to fill out after the surgery.

“Here, I’ll give you one more hint, but if you don’t answer this time, we’ll, you’ll feel soon enough how painful I can really make it.”

Mora sighs as she continues on once more.

“Kids used to call me ‘mutant’ back in school. I was always looked down upon because nobody knew who or what I was- no, more like they didn’t know how to scare me because I knew what they were capable of, while they were afraid of what I was- what I am.”

Hearing this, the man before her finally reacts, slowly moving his head up, for the first time looking Mora dead in the eyes.

She would be lying if she didn’t say that his stare didn’t scare her. It felt like he was carving her up with just his eyes as his mouth began to stretch into what appeared to be a smirk.

“So we’re the same then?”

Mora was taken aback by his sudden answer, noticing his voice was hoarse as he spoke. It takes her a moment to sort through her thoughts as she walks over toward the door, knocking twice.

In a matter of moments the red blinking light on the camera pointed at the man cease, signaling that nobody was watching them now. Mora walks back over toward the table, moving closer toward the man as she drops the volume of her voice to a whisper.

“So you’re a mutant type? No wonder those guys couldn’t handle you back there. Dumbasses don’t even know how to hold a gun half the time, much less deal with people unlike themselves.”

The man turns his head eerily as he looks back at Mora, seeming to drop his guard for a moment. This causes Mora to relax as she responds once more.

“I’m sure those guys haven’t been treating you well, are you thirsty?”

Nodding, the man smacks his lips at the lack of hydration. Walking back over to her side of the table, Mora grabs her bottle of water that sat by the legs of her cold chair. Once she grabs the half filled bottle, she walks back over toward the man as he appears to be pleading with his eyes in hopes of quenching his thirst.

“Now, since you’re restrained, I’m going to have to pour it into your mouth. If you want me to do that, I’m going to need you to promise that you won’t bite my finger or something, alright?”

The man shakes his head in response, this time appearing more eager than when he was brought in as he watched Mora’s fingers twist the cap off, titling the bottle toward him as he begins to open his mouth.

“Just to make sure, you aren’t going to bite me if I give you a drink?”

Looking back at the man once more, he shakes his head just as eagerly, giving Mora the scariest idea of ‘puppy-dog eyes’ she might have ever wished she could have unseen.

“Okay, I’ll try to be slow but let me know if it’s too much.”

Mora then places the top of the bottle onto the man's lip, beginning to pour the water into his mouth.

Despite her beliefs and her attitude toward those she called her ‘patients’, she couldn’t help but feel sympathy for the bastard. Mora is a lot of terrible terrible things, but knew she wasn’t some sort of cold monster that found satisfaction in others' pain. Especially since they had one thing in common, getting fucked over by the world because of who they were. The least she could do was show empathy for someone who seemed to have it worse than herself.

Before long, the man gulps down the remaining water, releasing the top from his mouth as Mora cautiously moves it away from him. Mora speak quietly once more as she twists the lid back on to the plastic bottle.

“Good, thank you for not trying to hurt me. You’d have no idea how many of these inmates would leap at the chance to do just that. It’s- it’s fucked up. Now… Since I feel safe enough to trust you, I think I should tell you something about why you’re in here with me…”

Mora looks away from the man as she feels guilt in what she knew she had to do. In the past, all she did was touch the patient and take away their power as she tried to block out their strained shrieks that made her ears bleed.

Now, because she extended an olive branch to this stranger, it made everything moving forward begin to feel all the more gut-wrenching. Despite this nauseating feeling that began to crawl up her throat, she felt it would be best to tell him the process, doctor to patient.

“I have to remove your ability from your body.”

As Mora says this, she works up the strength to push away her feelings of guilt by staring the man in the eyes as she broke the news.

“It’s an excruciatingly painful process and there is a 20% chance you could die before the procedure is complete.”

Mora could feel her strength begin to evaporate before her very eyes as she felt the bile crawl up her throat once more.

“In the event that that happens, I will still continue to extract your power from your body as emergency services attempt to revive you.”

‘Gods, I’m gonna fucking puke.’

“A-And I know you don’t have any choice in this, but- I’ll try to make it as painless as possible, and hopefully you won’t die.”

As she spoke, Mora can feel the tears begin to form in her eyes as her vision begins to blur. Before now, she was able to block off the painful wails of her past patients, feeling some pass on as she was forced to continue on with the procedure, Gods- somehow she was able to sleep at night before now.

She never thought too much about her power until now, but somehow, Mora became the grim reaper, selling strangers' souls to the highest bidder. The more she thought about it, the more she began to feel disgusted in herself for not realizing this for years! Maybe it was for her own sanity, or it was so she wouldn’t become a lab rat, but for some damn reason, she couldn’t forgive herself for acting so selfishly.

“I’m so sorry.”

Mora was at a loss for words as she felt a few tears begin to cascade down her cheeks as she forced her gaze at the man.

The pair sat in silence for what felt like hours, Mora eventually dropping her head in shame for what she had done and would have to do. Before long, the man speaks up.

“It’s not your fault. I deserve this. So please, don’t cry.”

Her breath is caught in her throat as she looks back up at the man. There was no reason for him to talk to comfort her when he was the one about to suffer. It wasn’t fair, none of this was fair for either of them. Before Mora can speak up in retaliation, the man speaks up once more.

“Before you take it away, could you do one thing?”

Mora nods energetically as she wipes her cheeks with the back of her hand, wiping her eyes with her knuckle in an attempt to give him her full attention.

“Whatever happens to me, could you please tell my family that everything they’ll need is in the basement?”

“I-I can!”

“Good good. I’m ready.”

In utter shock, Mora takes a moment before she stands up from her chair, clenching her fists in anger as she trudges toward the man.

Before Mora has a chance to rethink her decision, she places her hand on the man’s shiny bald head, forcing the breath she held to release as she began the surgery. As she does this, Mora can see the man attempting to restrain his howls of agony in the indescribable torture he must be feeling.

“I’m so sorry!”

As Mora says this, the man looks up at her, exhaling his last words as the process is nearly complete.

“Bring back peace.”

Mora’s bottom lip begins to quiver in guilt as she nods in response, not understanding the weight of the man's words.

After the procedure, Mora left early, deciding to get a breath of fresh air as she put it. Taking long strides in the direction of her home, she began to think back on the man’s words.

‘The hell did he mean by “Bring back peace”? Was he some sort of hippy that got into trouble? If that were the case then why was he a code 10?’

Mora’s thoughts continued to consume her attention as she failed to notice the looming shadow that didn’t seem to be too far behind her as it continued to stalk its prey.

‘Maybe he was a scapegoat? They didn’t really give me much information on his charges so he could have been some sort of cult leader for all we know. That- there was no way that could be it… So then, why-’

Suddenly, Mora was pulled from her thoughts as she felt a tug by her side. Before she had a chance to figure out what was happening, she felt her body being pulled away from the desolate streets and into a damp alleyway- pushed against what felt like a dirty brick wall as she felt a bit of her shirt tear.

In a mere few seconds, Mora went from walking home to suddenly being trapped in an alleyway between a brick wall and from what she could tell was a pistol as all she could see was the underside of the gun that was held against her forehead.

“Listen here bitch. If you so much as yell, I’m putting this entire magazine in your skull, ya got that?”

Without seeing another way out of this endeavor, Mora nodded as she looked toward the perpetrator, only able to recognize a scar that started at his top lip, continuing diagonally across, and ending a few centimeters away from his bottom lip. The assailant continued speaking as she felt her heart beating a mile a minute.

“Nobody has to get hurt, just reach into your purse there and give me all your money and I’ll be on my way, alright?”

Mora nods once more as she feels the metal cylinder against her temple shift in its position on her. Between this and the brick wall behind her, she’d never felt more suffocated now than all those years she spent in that stupid cell she currently wished she never left in the first place.

As she agrees to this, she slowly moves her purse straps from their comfy place on her shoulder, now sitting in her hands as she shakily reaches in to pull out her wallet.

‘Where the fuck is it?! Of all times, NOW I had to stuff it away somewhere else!? I’m so fucking dead…’

With weighted breath, she begins to speak as she continues to scrummage through her messy bag.

“I-I- heh, you’re not gonna believe this. I- uh, I can’t find my wallet.���

“You tryna fucking pull a fast one on me lady?!”

“N-No I swear I’m not, I-I think I left it at work.”

“Bullshit. If you don’t get your money out in three fucking seconds, there’s gonna be a bullet between your eyes.”

Mora began to panic as she knew exactly where she left her wallet in the locker room that morning.

The assailant began to count down, each second seeming to further paralyze the woman in fear as she couldn’t see any other way to escape her fate.

‘Is there really no way out of this? Is this where I die? Goddamnit-’

“One.”

Mora hears a shot fired from the man's gun, the ringing in her ears proving his threats were legitimate but- something was off.

As she looked up toward the gun, she could see the smoke from the firing at the front of the cylinder dissipate, but Mora didn’t feel...anything. No pain, no blood trickling down her face, nothing! She wasn’t sure what had happened but as she shakily reached up to feel the point of impact, she was met with a cool metal feeling. The thief standing before her stumbled back as he saw the chamber appeared to have exploded rather than fire off at its intended target.

“W-What the- D-Don’t think you’re off the hook just because you have a freeze type bitch! I-I’ll fucking kill you myself!”

Confused by his statement, Mora sat there stunned as she knew that this definitely wasn’t her ability at work. Suddenly, the man begins to charge at her, wrapping his hands around her neck in hopes of choking her.

Feeling her airway begin to close off, Mora instinctively reached her hand out toward the man, gripping at his arm as she attempted to remove the man’s ability in hopes of injuring him. Mora did injure him alright, just not the way she was attempting to do so as she looked to her hand and noticed it began to burn and glow a bright orange hue. In the blink of an eye, the man before her was suddenly engulfed in flames as he released her throat.

“YOU FUCKING PSYCHO!!! AHHHHG-!”

As the man frantically began to run around in circles, Mora lost strength in her legs as she slid down the brick wall, watching in both fear and amazement at what she had done. Looking down, she sat on the ground, pulling her hand toward her face as she noticed the orange hue continue to glow.

Suddenly, from the corner of her eye she saw the assailant fall to the ground, not attempting to extinguish the fire as his body laid there lifelessly. As she sees this, she notices the fire begins to burn out itself. Looking back at her hand, she notices the glow start to fade, nervously clenching it into a fist as she trembles in...excitement?

As Mora began to think that she’s lost her mind, another thought began to linger in the back of her mind.

‘I think I’ll keep this one for myself...’

#one-shot #power #reddit #reddit prompt #short story #should I continue? #Dunkaroo One Shots #tw: violence #tw: depression #tw: mentions of trauma #tw: mentions of childhood abuse #tw: read at your own digression #love to hear your thoughts #love to hear your feedback! #mha #my hero academia #bnha #boku no hero academia #quirk? #<3 #<3 Dunkaroo #<3 L. Dexter #lynn-dexter